GapMind for Amino acid biosynthesis

 

Alignments for a candidate for serB in Sinorhizobium meliloti 1021

Align Phosphoglycerate mutase family protein, putative (characterized, see rationale)
to candidate SMc02838 SMc02838 phosphoglyceromutase

Query= uniprot:N9V397
         (205 letters)



>FitnessBrowser__Smeli:SMc02838
          Length = 211

 Score = 44.7 bits (104), Expect = 1e-09
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 4  LILIRHGETEWNLLGKIQGCTDIELTPNGIQQANEVAQQIKG---NFDIIYSSPLHRALI 60
          L+L+RHG+++WNL     G  D +LT  GI++A    + +      FDI ++S L RA  
Sbjct: 5  LVLVRHGQSDWNLKNLFTGWRDPDLTELGIEEAKAGGKALADYGIKFDIAFTSVLIRAQR 64

Query: 61 TAQKI 65
          T Q +
Sbjct: 65 TCQLV 69


Lambda     K      H
   0.318    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 100
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 205
Length of database: 211
Length adjustment: 21
Effective length of query: 184
Effective length of database: 190
Effective search space:    34960
Effective search space used:    34960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory