Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate SMc00017 SMc00017 homoserine kinase
Query= reanno::Korea:Ga0059261_3253 (319 letters) >FitnessBrowser__Smeli:SMc00017 Length = 326 Score = 288 bits (737), Expect = 1e-82 Identities = 146/310 (47%), Positives = 201/310 (64%), Gaps = 2/310 (0%) Query: 1 MAVYTQVSAEALAGFLARYDVGELVSAKGIAEGVENSNYLVETTRDRFILTLYEKRVEAA 60 MAVYT ++ + L FLA Y+VG L S KGIAEGVENSN+L+ TT+ +ILTLYEKRV A Sbjct: 1 MAVYTDITEDELIRFLAAYEVGSLTSYKGIAEGVENSNFLLHTTKGAYILTLYEKRVNAD 60 Query: 61 DLPYFMGLLDHLAAKGLPVPPAIKDRGGVEIQELNGRPACLIKFLSGISLSHPTPAQARA 120 DLP+F+GL+ HLA +GL P + G + L+GRPA +I FL G+ L P R Sbjct: 61 DLPFFLGLMHHLAERGLSCPLPLPRADGKLLGTLSGRPAAVISFLEGMWLRKPEAQHCRE 120 Query: 121 AGEAMAQMHRAVADFPLDRPNSMGVDTWQPLFEKCGHSLDQIVPGLYDDLGFAIARVVPA 180 G A+A MH+A FPL RPN++ V+ W+PL+ D++ GL D++ +A + Sbjct: 121 VGRALASMHQAGEGFPLKRPNALSVEGWRPLWRNSEARADEVQAGLKDEIATELAFIEEH 180 Query: 181 WTRNDFDRCAIHADLFPDNVLMRGDQVTGLIDFYFACTDIRVYDLAVMHSAWSFDAHGRN 240 W + D IHADLFPDNV GD+++GLIDFYFAC D YD+A+ ++W F+ G + Sbjct: 181 WPK-DLPEGVIHADLFPDNVFFLGDRLSGLIDFYFACNDFLAYDVAICLNSWCFEKDG-S 238 Query: 241 YDPAVGDALIAGYEASFPLTEVERAAFPTLAAGACIRFSLSRAWDWLNTPADALVMRKDP 300 Y+ G AL++GYE+ LT E A P LA G+ +RF L+R +DWL TP ALV++KDP Sbjct: 239 YNITKGMALLSGYESVRRLTAEEIEALPLLARGSALRFFLTRLYDWLMTPPGALVVKKDP 298 Query: 301 LAYVRRLKHY 310 L Y+ +++ + Sbjct: 299 LEYLTKIRFH 308 Lambda K H 0.323 0.138 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 326 Length adjustment: 28 Effective length of query: 291 Effective length of database: 298 Effective search space: 86718 Effective search space used: 86718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
Align candidate SMc00017 SMc00017 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.18559.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-125 404.2 0.0 2.1e-125 404.0 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc00017 SMc00017 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc00017 SMc00017 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 404.0 0.0 2.1e-125 2.1e-125 1 306 [. 1 306 [. 1 307 [. 0.99 Alignments for each domain: == domain 1 score: 404.0 bits; conditional E-value: 2.1e-125 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflellthLaer 75 mavyt+++++el fL y++G l s kGiaeGvensn+ll t+kg y+Ltlyekrv+a++LPffl l++hLaer lcl|FitnessBrowser__Smeli:SMc00017 1 MAVYTDITEDELIRFLAAYEVGSLTSYKGIAEGVENSNFLLHTTKGAYILTLYEKRVNADDLPFFLGLMHHLAER 75 9************************************************************************** PP TIGR00938 76 glpvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlaklhlagadfkeerkndlrleaWsi 150 gl+++ p+++ dG++l++L+G+Paa+++fL+G+ ++kP a++crevg la +h ag++f+ +r n l+ e W++ lcl|FitnessBrowser__Smeli:SMc00017 76 GLSCPLPLPRADGKLLGTLSGRPAAVISFLEGMWLRKPEAQHCREVGRALASMHQAGEGFPLKRPNALSVEGWRP 150 *************************************************************************** PP TIGR00938 151 laakkfkvleqleeelaalldkeldalkkflprdLPrgvihadlfkdnvlldgdklkgvidfyfaCedallydla 225 l + +++++++l++++ +el+++++ +p+dLP+gvihadlf+dnv++ gd+l+g+idfyfaC+d l+yd+a lcl|FitnessBrowser__Smeli:SMc00017 151 LWRNSEARADEVQAGLKDEIATELAFIEEHWPKDLPEGVIHADLFPDNVFFLGDRLSGLIDFYFACNDFLAYDVA 225 ***99999******************************************************************* PP TIGR00938 226 iavndWcfeaddkldaaaakallkgyeavrpLseeekaafpvllrgaalrfllsrlldlvftqagelvvakdPae 300 i++n Wcfe+d+++++++ all gye+vr L++ee +a+p l+rg+alrf+l+rl d+ +t++g+lvv kdP e lcl|FitnessBrowser__Smeli:SMc00017 226 ICLNSWCFEKDGSYNITKGMALLSGYESVRRLTAEEIEALPLLARGSALRFFLTRLYDWLMTPPGALVVKKDPLE 300 *************************************************************************** PP TIGR00938 301 ferkLk 306 + k++ lcl|FitnessBrowser__Smeli:SMc00017 301 YLTKIR 306 *98876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (326 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.77 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory