GapMind for Amino acid biosynthesis

 

Alignments for a candidate for thrB in Sinorhizobium meliloti 1021

Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate SMc00017 SMc00017 homoserine kinase

Query= SwissProt::P29364
         (316 letters)



>FitnessBrowser__Smeli:SMc00017
          Length = 326

 Score =  199 bits (505), Expect = 1e-55
 Identities = 117/281 (41%), Positives = 156/281 (55%), Gaps = 2/281 (0%)

Query: 1   MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVE-RGPVQ 59
           M+V+T +    L  FLA Y++G L  ++GIAEG ENSNF +    G ++LTL E R    
Sbjct: 1   MAVYTDITEDELIRFLAAYEVGSLTSYKGIAEGVENSNFLLHTTKGAYILTLYEKRVNAD 60

Query: 60  DLPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQE 119
           DLPFF+ L+  L E GL  P  L   DG+ L  L G+PA +   L G   R+P A HC+E
Sbjct: 61  DLPFFLGLMHHLAERGLSCPLPLPRADGKLLGTLSGRPAAVISFLEGMWLRKPEAQHCRE 120

Query: 120 VGDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAE 179
           VG  L  +H A  G  L+RP+   +        N   R  E    L      E+A ++  
Sbjct: 121 VGRALASMHQAGEGFPLKRPNALSVEGWRPLWRNSEARADEVQAGLKDEIATELAFIEEH 180

Query: 180 RPA-LPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLD 238
            P  LP   +HADLF DNV F G  L+GLIDFY AC+ ++ YD+AI LN WC   DGS +
Sbjct: 181 WPKDLPEGVIHADLFPDNVFFLGDRLSGLIDFYFACNDFLAYDVAICLNSWCFEKDGSYN 240

Query: 239 PARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRL 279
             +  ALL+ Y + R  TA E E  P + R + +RF+L+RL
Sbjct: 241 ITKGMALLSGYESVRRLTAEEIEALPLLARGSALRFFLTRL 281


Lambda     K      H
   0.324    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 261
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 316
Length of database: 326
Length adjustment: 28
Effective length of query: 288
Effective length of database: 298
Effective search space:    85824
Effective search space used:    85824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)

Align candidate SMc00017 SMc00017 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))

Software error:

../bin/blast/fastacmd -i /tmp/list.4223.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.4223.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.