GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Sinorhizobium meliloti 1021

Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate SMc00884 SMc00884 dihydroxy-acid dehydratase

Query= curated2:A8AB39
         (552 letters)



>lcl|FitnessBrowser__Smeli:SMc00884 SMc00884 dihydroxy-acid
           dehydratase
          Length = 574

 Score =  362 bits (930), Expect = e-104
 Identities = 217/546 (39%), Positives = 318/546 (58%), Gaps = 17/546 (3%)

Query: 15  HRALWRASGLIDEELR-RPLIGVANSWNEIVPGHVHLDKVAEAVKAGIRMAGGTPLEFGT 73
           HR+  +  G  D     RP+IG+ N+W+E+ P + HL  +AE VK G+  AGG P+EF  
Sbjct: 24  HRSWMKNQGFPDHVFDGRPIIGICNTWSELTPCNSHLRILAEGVKRGVWEAGGFPVEFPV 83

Query: 74  IAVCDGIAMGHEGMR-YSLPSREVIADTVEIMVEAHRLDAVVMVTNCDKITPGFLLAAAR 132
            +      +G   MR  ++  R ++A  VE  + A+ +D VV++  CDK TPG L+ AA 
Sbjct: 84  SS------LGETQMRPTAMLFRNLLAMDVEEAIRAYGIDGVVLLGGCDKTTPGQLMGAAS 137

Query: 133 LEVPVILINGGPMMPGVYGKERIDFKDLMERMNVLIKEGRT--EELRKLEESALPGPGSC 190
           +++P I+++ GPM+ G +  + I     + + +  ++ G    +E    E      PG C
Sbjct: 138 VDLPTIVVSSGPMLNGKWKGKDIGSGTDVWKFSEAVRAGEMSLQEFMAAESGMSRSPGVC 197

Query: 191 AGLFTANTMNMLSEAMGLMLPGASTVPAVEARRLWYAKLTGMRIVKMVEEGLTPDKILTR 250
             + TA TM  + EAMGL LP  + +PAV+ARR+  + +TG RIV+MV E L   KILT+
Sbjct: 198 MTMGTATTMASIVEAMGLSLPTNAALPAVDARRMALSHMTGKRIVEMVHEDLRLSKILTK 257

Query: 251 KALENAIAVDMALGGSTNSVLHLEALAYELGIDLPLEVFDEISRKVPHIASISPSGRHFV 310
           +  EN I  + A+GGSTN+V+H+ A+A   GIDL LE FD +  +VP I +  PSG++ +
Sbjct: 258 ENFENGIIANAAVGGSTNAVVHMLAIAGRAGIDLCLEDFDRVGGQVPCIVNCMPSGKYLI 317

Query: 311 VDLDRAGGIPAVLKELGEAGLIHKDALTVTGKTVWENVKDAAVLDREVIRPLDNPYSPFG 370
            DL  AGG+PAV+  +    L+H DA TV G  + +  + A V + +VIRPLDNP     
Sbjct: 318 EDLAYAGGLPAVMNRIQH--LLHPDAPTVFGVPISKYWEAAEVYNDDVIRPLDNPLRAAA 375

Query: 371 GLAILKGSLAPNGAVVKASAVKRELWKFKGVARVFDREEDAVKAIRGGE--IEPGTVIVI 428
           G+ +LKG+LAPNGAV+K SA    L   +G A VFD  ED    I   +  +   T++V+
Sbjct: 376 GIRVLKGNLAPNGAVIKPSAASEHLLAHEGPAYVFDTIEDLRAKIDDPDLPVTEDTILVL 435

Query: 429 RYEGPRGGPGMREM--LTATAAVMALGLGDKVALVTDGRFSGATRGPAIGHVSPEAAAGG 486
           +  GP+G PGM E+  +     ++  G+ D V  ++D R SG   G  + HVSPEA AGG
Sbjct: 436 KGCGPKGYPGMAEVGNMPIPRRLVEKGVRDMVR-ISDARMSGTAFGTVVLHVSPEANAGG 494

Query: 487 PIALVQDGDEIVIDIEKRRLDLLVDEKELEERRARWKPKVKPLRRGILRRYAKMALSADK 546
           P+A+V+ GD I +D  K  L+LLV E+EL  R A W+P  +   RG  + Y    L ADK
Sbjct: 495 PLAIVRTGDRIRLDALKGELNLLVSEEELAARMAAWQPPEQKWHRGYYKLYHDTVLQADK 554

Query: 547 GGALEY 552
           G  L++
Sbjct: 555 GADLDF 560


Lambda     K      H
   0.319    0.138    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 894
Number of extensions: 37
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 574
Length adjustment: 36
Effective length of query: 516
Effective length of database: 538
Effective search space:   277608
Effective search space used:   277608
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory