GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Sinorhizobium meliloti 1021

Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate SMc04144 SMc04144 dihydroxy-acid dehydratase

Query= curated2:Q8TW40
         (549 letters)



>lcl|FitnessBrowser__Smeli:SMc04144 SMc04144 dihydroxy-acid
           dehydratase
          Length = 574

 Score =  372 bits (956), Expect = e-107
 Identities = 217/538 (40%), Positives = 308/538 (57%), Gaps = 14/538 (2%)

Query: 15  HRALLRACGLTDEEM-DRPFVAVVNTYSEVVPGHMHLDKVTEAVKAGIRMAGGVPFEVET 73
           HR+ L   G    E+ ++P +A++NT+S++ P H HL    E VK G+  AGG P E+  
Sbjct: 26  HRSRLYQMGYDHAELANKPVIAIINTWSDINPCHAHLRARAEEVKRGVWQAGGFPIELPA 85

Query: 74  IALCDGIAMNTPGMKYSLPSRELVADTIETVIEAHRFDGFVAIVSCDKMVPGALMAAARL 133
           ++L +     T  M Y    R  +A  +E +I +H  DG V +  CDK  PG +M A ++
Sbjct: 86  MSLAETYVKPTT-MLY----RNFLAMEVEELIRSHPVDGVVLLAGCDKTTPGTIMGAIQV 140

Query: 134 DLPAAIVTGGPMEPGCVDGERVDL-IDAFEAVGAYEEGEISEEELEELEQRACPGPGSCA 192
           DLP   V  GPM  G   G  +    D ++     E G ++E E  E+E+      G+C 
Sbjct: 141 DLPTIFVPAGPMLRGNYRGRMLGSGSDVWKYWAEKEAGRVTENEWSEMERGIARSFGTCM 200

Query: 193 GMFTANTMACMTEVLGMSEFNCAATPATEAEKLRVAKLTGMRIVEAIEEGITARDVLTRE 252
            M TA+TM  + + LG+S    +A PA +A   R+A L+G RIVE + E +   D+LT +
Sbjct: 201 TMGTASTMTALADTLGLSLPGASAIPAADAGHARMAALSGARIVEMVFEDLKPSDILTAK 260

Query: 253 AFLDAIRVDMALGGSTNTVLHLLAIAREADVELSLDDFDELSRETPHLCAMRPGGPYTMR 312
           AF +A+ V MA+ GSTN ++HL+AIAR   V L+LDDFD +S E P LC +RP G + M 
Sbjct: 261 AFENALAVHMAMAGSTNAMIHLIAIARRCGVPLTLDDFDRVSAEVPVLCNIRPTGEFLME 320

Query: 313 DLYEAGGVPAVMKELADDLHLDRIDFAGRSMRERVERTEVKDREVIRPKEDPVHEEGGIV 372
           D Y AGG+ A+ K+L   LH    +  G ++   ++  EV   EVIRP + PV   GG  
Sbjct: 321 DFYYAGGLIALWKQLKPLLHTGERNVIG-TIGGALDEAEVHLPEVIRPLDRPVAARGGTA 379

Query: 373 VLYGNLAPKGAVIKTAALSEEMYEHEGPAVVFDSEEEATEAILGGDID--PGDVVVIRYE 430
           +L GNLAP+G V+K AA    + +H GPA+VFD  +   +A+   D+D     V+++R  
Sbjct: 380 ILKGNLAPQGCVMKPAAADPALLQHRGPALVFDDYDAMMKAVNDDDLDVTADTVMILRNA 439

Query: 431 GPAGGPGMRE--MLTPTAALCGMGLDDSVALVTDGRFSGGTRGPCVGHVSPEAYRGGPIA 488
           GP GGPGM E  ML     L   G+ D V  ++D R SG + G C+ HV+PEAY GGP+A
Sbjct: 440 GPVGGPGMPEWGMLPIPRKLLKEGVRDMVR-ISDARMSGTSYGACILHVAPEAYVGGPLA 498

Query: 489 VVEEGDTIRLDVRERRLEVDVEDEELEARLEEWEPPE-DEVTGYLRRYRELVRGADEG 545
            V  GD I LDV  R + ++V+  E+E RL EW PPE D   GYL+ + E ++ A EG
Sbjct: 499 AVRNGDIIALDVARRTITLEVDQAEIERRLAEWRPPERDYSRGYLKMHAEHIQQAPEG 556


Lambda     K      H
   0.317    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 828
Number of extensions: 38
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 549
Length of database: 574
Length adjustment: 36
Effective length of query: 513
Effective length of database: 538
Effective search space:   275994
Effective search space used:   275994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory