Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate Synpcc7942_0031 Synpcc7942_0031 aminotransferase
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >FitnessBrowser__SynE:Synpcc7942_0031 Length = 424 Score = 152 bits (384), Expect = 2e-41 Identities = 129/399 (32%), Positives = 189/399 (47%), Gaps = 36/399 (9%) Query: 19 APAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWHT-GNG 77 AP V G+G+RL G+E ID VN GHAH R+V+A+ +QA H G Sbjct: 17 APDPLKVVSGKGARLTLADGRELIDCISSWWVNLHGHAHLRIVEAIAQQAATLEHVIFAG 76 Query: 78 YTNEPVLRLAKQL--IDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGIVAFK 135 +++EP RLA +L I RVFF ++G+ A E ALK+A +Y H+ +S I+AF Sbjct: 77 FSHEPAERLAMELCKILPEKLTRVFFSDNGSTAVEVALKMALQYWHN-LDQPRSRILAFD 135 Query: 136 NAFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAIY------NDLDSAK----------AL 179 A+HG T +S G + ++ F L ++ Y ++ AK AL Sbjct: 136 GAYHGDTFGAMSVGERSLFNAPFEKLLFSVEFLPYPETWWGDETVEAKEAAAIAAVEQAL 195 Query: 180 IDDNTCAVIVEPM-QGEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAY 238 + AVI+EP+ QG GG+ A FL+ L A +LLI DEV TG GRTG +A Sbjct: 196 AAGDVAAVIIEPLVQGAGGMRMARPQFLQQLAARVQAAGSLLIADEVMTGFGRTGAWFAC 255 Query: 239 MHYGVTPDLLSTAKALGGGF-PIGALLASERCASVMTVGT------HGTTYGGNPLACAV 291 G+ PDL+ +K L GGF P+ +A+E G HG +Y NPL CA Sbjct: 256 QRAGIQPDLICLSKGLTGGFLPLSITVATEVIYDTFCSGNPDHTFYHGHSYTANPLGCAA 315 Query: 292 A-GEVFATINTREVLNGVKQRHQWFCERLNAINARYGLFKEIRGLGLLIGCVLKDEYAGK 350 A + +++ ++ G++ H E L A++ R G + C L + G Sbjct: 316 AIASLELLLDSEAIVQGLEDAHLPGLELL----AQHPKVTRPRLTGGIAACDLVSDRGGY 371 Query: 351 AKAIS---NQAAEEGLMILIAGANVVRFAPALIISEDEV 386 I QAA ++L NV+ P ++ E+ Sbjct: 372 LDPIGLRVRQAAIARGLLLRPLGNVLYLLPPYCLTPTEL 410 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 424 Length adjustment: 31 Effective length of query: 375 Effective length of database: 393 Effective search space: 147375 Effective search space used: 147375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory