Align Aspartate--tRNA(Asp/Asn) ligase; EC 6.1.1.23; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS (uncharacterized)
to candidate Synpcc7942_0830 Synpcc7942_0830 asparaginyl-tRNA synthetase
Query= curated2:Q8TXG4 (431 letters) >FitnessBrowser__SynE:Synpcc7942_0830 Length = 462 Score = 218 bits (555), Expect = 3e-61 Identities = 155/446 (34%), Positives = 222/446 (49%), Gaps = 43/446 (9%) Query: 16 GEEVRLAGWVHEVRDLGGIKFVLLRDRTGI--VQLTLPKQKVPKETFEKVPKLTKESVIR 73 G+ V + GW+ R L FV + D + + +Q+ L ++ E K +L + I Sbjct: 16 GQTVVVRGWIRTARQLKEFTFVEVNDGSCLKGIQVVLGQELADYEMLAK--QLDTGAAIA 73 Query: 74 VEGTVQANEKAPGGVEVIPQRIEVLSESDTHLPLDPTGKVDADLDTRLDARVLDLRREEP 133 VEG + A+ VE+ +E++ +D P K + L R Sbjct: 74 VEGQLVASPAKGQRVELQAASVEIVGGADPEQY--PLQKKRHSFEFLRTIAHLRPRTNSL 131 Query: 134 QAIFKIRNVVTTAIREFLEERGFIEVHTPKIIASATEGGTELFPVV-------------- 179 A+ ++RN TAI +F +ERGF+ VHTP I AS EG ELF V Sbjct: 132 GAVMRVRNAAATAIHDFFQERGFLWVHTPIITASDCEGAGELFTVTNLDLDKLGQSQQAP 191 Query: 180 -----YFERDAYLAQSPQLYKQMLMAAGFERVYEIGPIFRAEEHNTRRHLNEAISVDIEM 234 +F + AYL S QL + +MA F VY GP FRAE NT RHL E V+ EM Sbjct: 192 DFEQDFFGKRAYLTVSGQLEAE-IMALAFSNVYTFGPTFRAENSNTSRHLAEFWMVEPEM 250 Query: 235 SFIESEEDVMRVLEELLAHVFRKVREECEKELE---------ALDRELPELETPFERITY 285 +F + D M + E L VF++V + C ++LE L+R L FER++Y Sbjct: 251 AFCDLGGD-MDLAEAFLKFVFQRVSDRCSEDLEFFNQRIDSEVLNRAETILNNDFERVSY 309 Query: 286 EETLDLLSE----HGIEVEWGEDLPTEAERKLGE-IFEEPFFITEWPRETRPFYTMAKDD 340 + + LL + V WG DL +E ER L E F +P + ++PRE + FY DD Sbjct: 310 TDAIALLEKADRSFDYPVAWGIDLQSEHERYLAEEYFRKPLIVYDYPREIKAFYMRLNDD 369 Query: 341 EVTTA-FDLMYQGL-ELASGAQREHRYDVLVRQIEEQGLSPEDFRHYLEAFKYGMPPHGG 398 + T A D++ G+ E+ G+QRE R DVL +++ E L E++ YL+ +YG PH G Sbjct: 370 QKTVAAMDVLAPGIGEIIGGSQREERLDVLKQRLAEANLPEENYWWYLDLRRYGSVPHAG 429 Query: 399 WGLGLERTLMTITGAENIREVTLFPR 424 +GLG ER + ITG NIR+V FPR Sbjct: 430 FGLGFERLVQFITGMGNIRDVIPFPR 455 Lambda K H 0.318 0.138 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 462 Length adjustment: 33 Effective length of query: 398 Effective length of database: 429 Effective search space: 170742 Effective search space used: 170742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory