Align Probable cystathionine beta-synthase Rv1077; Beta-thionase; Serine sulfhydrase; EC 4.2.1.22 (characterized)
to candidate Synpcc7942_0171 Synpcc7942_0171 cysteine synthase A
Query= SwissProt::P9WP51 (464 letters) >FitnessBrowser__SynE:Synpcc7942_0171 Length = 372 Score = 246 bits (627), Expect = 1e-69 Identities = 140/322 (43%), Positives = 192/322 (59%), Gaps = 9/322 (2%) Query: 1 MRIAQHISELIGGTPLVRLNSVVPDGAGTVAAKVEYLNPGGSSKDRIAVKMIEAAEASGQ 60 M I + IG TPL+RLNS+ + K E+LNPGGS KDR A+ +IE AE G+ Sbjct: 45 MDIRNGFIDTIGNTPLIRLNSLSEATGCNILGKAEFLNPGGSVKDRAALFIIEDAERQGK 104 Query: 61 LKPGGTIVEPTSGNTGVGLALVAQRRGYKCVFVCPDKVSEDKRNVLIAYGAEVVVCPTAV 120 L+PGGT+VE T+GNTG+GLA + +GY+C+ V P+ S++K ++L GAEV P AV Sbjct: 105 LRPGGTVVEGTAGNTGIGLAHICNAKGYRCLIVIPETQSQEKIDLLRTLGAEVRTVP-AV 163 Query: 121 PPHDPASYYSVSDRLVRDIDGAWKPDQYANPEGPASHYVTTGPEIWADTEGKVTHFVAGI 180 P DP +Y VS RL ++D A +Q+ N +HY TTGPEIW TEG V +VA Sbjct: 164 PYRDPNNYVKVSGRLAEELDNAIWANQFDNLANRQAHYATTGPEIWQQTEGTVDAWVAAT 223 Query: 181 GTGGTITGAGRYLKEVSGGRVRIVGADPEGS-VYSG-GAGRPYL-----VEGVGEDFWPA 233 GTGGT G YLKE S +VR V ADP GS +YS G +L EG+G A Sbjct: 224 GTGGTYAGVALYLKEQS-SKVRCVVADPMGSGLYSWVKTGEIHLEGSSVTEGIGNSRITA 282 Query: 234 AYDPSVPDEIIAVSDSDSFDMTRRLAREEAMLVGGSCGMAVVAALKVAEEAGPDALIVVL 293 D+ I ++D ++ ++ +L + + +GGS G+ V AA ++A+E GP IV + Sbjct: 283 NMQDVPIDDAIQIADPEALEIIYQLLHRDGLFMGGSVGINVAAAYRLAKEMGPGHTIVTV 342 Query: 294 LPDGGRGYMSKIFNDAWMSSYG 315 L DGG Y S++FN W++S G Sbjct: 343 LCDGGARYQSRLFNAEWLASKG 364 Lambda K H 0.316 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 372 Length adjustment: 31 Effective length of query: 433 Effective length of database: 341 Effective search space: 147653 Effective search space used: 147653 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory