Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate Synpcc7942_B2623 Synpcc7942_B2623 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__SynE:Synpcc7942_B2623 Length = 329 Score = 177 bits (449), Expect = 3e-49 Identities = 115/305 (37%), Positives = 162/305 (53%), Gaps = 15/305 (4%) Query: 7 LLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADG 66 L + +GNTPLV LQ + ++ G + KLE NP GS+KDR A+ +I+ A + G Sbjct: 8 LTEWIGNTPLVRLQETAQQY-----GAIAEVLLKLEYLNPLGSVKDRTALSLIQSARSQG 62 Query: 67 LLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAAE 126 L+ G T++EPT+GNTGI LA AA + RLI VMP+ S ER +L +L GA+++ + A Sbjct: 63 LITAGTTLIEPTTGNTGIGLAFAAAAEQLRLILVMPDRVSAERIRLAKLLGAKVVLTPAA 122 Query: 127 GGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVAGLGT 185 +A A+ L P V+L Q+ NPAN H TGPE+ D E+ VAG+GT Sbjct: 123 EAMLGCIAKAQALQQQIPDSVILQQFQNPANPSIHQATTGPEIWRDTDGEVDIVVAGVGT 182 Query: 186 TGTLMGTGRFLREHVANVKIVAAEPRY-------GEGVYALRNMDEGFVPELYDPEILTA 238 GTLMG R+L+ ++ +A +P G + L M FV L D ++ Sbjct: 183 GGTLMGISRYLKPLRPRLQSIAVQPARSPVLSGGAAGSHQLTGMGPNFVSPLVDRSLIDE 242 Query: 239 RYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADAGW 298 S DA+ R EGI G+S+GA++ AAL V AG+R I V Sbjct: 243 ILSAYEEDAIAVIRTCAAREGIPLGVSSGAIVWAALQVAKRPENAGKR--IVAVCPSGSE 300 Query: 299 KYLST 303 +YLS+ Sbjct: 301 RYLSS 305 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 329 Length adjustment: 28 Effective length of query: 295 Effective length of database: 301 Effective search space: 88795 Effective search space used: 88795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory