Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate Synpcc7942_0191 Synpcc7942_0191 Serine--glyoxylate transaminase
Query= BRENDA::Q56YA5 (401 letters) >FitnessBrowser__SynE:Synpcc7942_0191 Length = 382 Score = 226 bits (577), Expect = 7e-64 Identities = 137/380 (36%), Positives = 214/380 (56%), Gaps = 7/380 (1%) Query: 12 LFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPTTGTG 71 L +PGP +PE V+ AM ++ +RS L +K + +TT G + ++GTG Sbjct: 7 LMIPGPTPVPEQVLLAMAKHPIGHRSADFSRLVADTTAGLKWLHQTT-GNVLVLCSSGTG 65 Query: 72 AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLS 131 A E+ + N LS GDR++ G+F W+ + +VD+V++ WG+ + + + +KL Sbjct: 66 AMEAGIINFLSAGDRVLCCENGKFGERWVKLAQAFGLDVDLVQAPWGKPLDPEAIRAKLE 125 Query: 132 QDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWG 191 D + IKA+ + H+ET+TGV ND+ + + H AL +VD V+S+ A + +D WG Sbjct: 126 ADTDKQIKAVILTHSETSTGVINDLETISGYI--RAHGALSIVDAVTSLGAANVPIDAWG 183 Query: 192 VDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTP 251 +DV +GSQK +P GLG V S +A +A +T+ K + D Y K + + P+TP Sbjct: 184 LDVVASGSQKGYMIPPGLGFVAVSDRAWKAYETATLPKFYLDLGKYRKAAQKDSN-PFTP 242 Query: 252 SIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAV 311 + L Y L AAL ++ EGLENI ARHA+L +ATR A++A L +E S +TAV Sbjct: 243 PVNLYYALDAALKIMQREGLENIFARHAKLTRATRAAIKALNLP-LYAADEVGSPAITAV 301 Query: 312 MVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILK 371 P + +I + +++ L G + + GK+FRIGHLG V+ +L +A +E L Sbjct: 302 -APVEVAAEDIRSFTKKHFDILLAGGQDDLKGKIFRIGHLGFVSGRDVLTAIAAIEAALT 360 Query: 372 DVGYP-VVMGSGVAAASTYL 390 +GY G+GVAAA+ L Sbjct: 361 GLGYSNFTSGAGVAAAAAEL 380 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 382 Length adjustment: 31 Effective length of query: 370 Effective length of database: 351 Effective search space: 129870 Effective search space used: 129870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory