GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvC in Synechococcus elongatus PCC 7942

Align ketol-acid reductoisomerase (NAD+) (EC 1.1.1.382); ketol-acid reductoisomerase (NADP+) (EC 1.1.1.86) (characterized)
to candidate Synpcc7942_1552 Synpcc7942_1552 ketol-acid reductoisomerase

Query= BRENDA::C8WR67
         (344 letters)



>FitnessBrowser__SynE:Synpcc7942_1552
          Length = 327

 Score =  449 bits (1155), Expect = e-131
 Identities = 225/326 (69%), Positives = 266/326 (81%), Gaps = 1/326 (0%)

Query: 4   IYYDADISIQPLADKRIAVIGYGSQGHAHAQNLRDSGFDVVIGLRPGS-SWAKAEADGFR 62
           +YYDAD ++  L  K +A+IGYGSQGHAHA NLRDSG +VV+GL PGS S AKAEA+G +
Sbjct: 1   MYYDADANLDLLNGKTVAIIGYGSQGHAHALNLRDSGVNVVVGLYPGSKSAAKAEAEGLK 60

Query: 63  VMAVGEAVEESDVIMILLPDERQPAVYEREIRPYLTAGKALAFAHGFNIHFSQIQPPKDV 122
           V+ V EA + +D IMILLPDE Q +V+E EIRP L+AGK LAFAHGFNIHF+QI PP DV
Sbjct: 61  VLPVAEAAQAADWIMILLPDEFQKSVFENEIRPALSAGKVLAFAHGFNIHFAQIVPPADV 120

Query: 123 DVFMVAPKGPGHLVRRVYEAGGGVPALIAVHQDASGQAKDLALAYARGIGAGRAGILTTT 182
           DV M+APK PGHLVRR YE G GVP L A++QDASGQA+D A+AYA+GIG  RAGIL T+
Sbjct: 121 DVVMIAPKSPGHLVRRTYEQGQGVPCLFAIYQDASGQARDRAMAYAKGIGGTRAGILETS 180

Query: 183 FREETETDLFGEQAVLCGGLSALIKAGFETLVEAGYQPEIAYFECLHEMKLIVDLIYEGG 242
           FREETETDLFGEQAVLCGGLSALIKAGFETLVEAGYQPE+AYFECLHE+KLIVDLI EGG
Sbjct: 181 FREETETDLFGEQAVLCGGLSALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLIVEGG 240

Query: 243 LEYMRYSISDTAQWGDFTSGPRIINEETKKEMRRILADIQSGAFAKSWILENQANRPMFN 302
           L  MR SIS+TA++GD+ +GPR+I EETK EM+R+LADIQ G FA  ++ E  A +P+  
Sbjct: 241 LAAMRDSISNTAEYGDYVTGPRLITEETKAEMKRVLADIQQGRFALDFVQECGAGKPVMT 300

Query: 303 AINRRELEHPIEVVGRKLRSMMPFIK 328
           A  R E EHPIE VG+ LR+M  ++K
Sbjct: 301 ATRRLEAEHPIESVGKDLRAMFSWLK 326


Lambda     K      H
   0.320    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 388
Number of extensions: 13
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 344
Length of database: 327
Length adjustment: 28
Effective length of query: 316
Effective length of database: 299
Effective search space:    94484
Effective search space used:    94484
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Synpcc7942_1552 Synpcc7942_1552 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))

Software error:

../bin/blast/fastacmd -i /tmp/list.28216.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.28216.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.