Align 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (characterized)
to candidate Synpcc7942_2136 Synpcc7942_2136 dihydrodipicolinate reductase
Query= BRENDA::P9WP23 (245 letters) >FitnessBrowser__SynE:Synpcc7942_2136 Length = 273 Score = 207 bits (527), Expect = 2e-58 Identities = 117/268 (43%), Positives = 164/268 (61%), Gaps = 29/268 (10%) Query: 3 VGVLGAKGKVGATMVRAVAAADDLTL------SAELDAGD--------PLSLLTDGNTE- 47 V V GA GK+G ++A+AAADD+TL SA++ D PL + + E Sbjct: 7 VVVNGATGKMGRETIKAIAAADDVTLVGAIARSADVQGQDIGEIVGLGPLEVPVTNDLEG 66 Query: 48 ------------VVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKP 95 VV+DFTHPD + N+ I G+ VVGTTG E+ Q++ + K Sbjct: 67 MLCLASQEREVPVVVDFTHPDCIYDNVRKAIAYGVRPVVGTTGLNNEQLQELAEF-AEKA 125 Query: 96 NTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEAR 155 + L+ PNF+IG VL M A QA+RF+D E++ELHH KADAPSGTA +TA+++AE Sbjct: 126 SVGCLVIPNFSIGMVLLMQAAIQASRFYDHVEILELHHDQKADAPSGTAIKTAQMLAELG 185 Query: 156 KGLPPNPDATSTSLPGARGA-DVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDR 214 K P ++PGARGA + I +H+VRL GL+AH+EV+FG GE LT+RHD++DR Sbjct: 186 KTFNPPKVTEKETMPGARGAVGPENIRIHSVRLPGLIAHEEVIFGAPGEILTLRHDTMDR 245 Query: 215 TSFVPGVLLAVRRIAERPGLTVGLEPLL 242 + ++PGVLLAVR++ + GL GL+ +L Sbjct: 246 SCYMPGVLLAVRKVRQLTGLIYGLDRIL 273 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 245 Length of database: 273 Length adjustment: 24 Effective length of query: 221 Effective length of database: 249 Effective search space: 55029 Effective search space used: 55029 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Synpcc7942_2136 Synpcc7942_2136 (dihydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.23875.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-93 299.1 0.0 1.8e-93 299.0 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2136 Synpcc7942_2136 dihydrodipicolin Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2136 Synpcc7942_2136 dihydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 299.0 0.0 1.8e-93 1.8e-93 2 269 .. 5 273 .] 4 273 .] 0.96 Alignments for each domain: == domain 1 score: 299.0 bits; conditional E-value: 1.8e-93 TIGR00036 2 ikvavaGaaGrmGrevikavkeaedlelvaalerkgsskqgkDiGelagigkvgvpveddleavkvla. 69 i+v+v+Ga+G+mGre ika+++a+d+ lv+a+ ++ + qg+DiGe++g+g+++vpv++dle + la lcl|FitnessBrowser__SynE:Synpcc7942_2136 5 IPVVVNGATGKMGRETIKAIAAADDVTLVGAIA-RSADVQGQDIGEIVGLGPLEVPVTNDLEGMLCLAs 72 79*******************************.599**************************999988 PP TIGR00036 70 .ekkadvliDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnl 137 e+++ v++Dft+p+ ++nv+ a+++gvr+VvGTTG+++e+l+el+++aek++v++++ pNf+iG++l lcl|FitnessBrowser__SynE:Synpcc7942_2136 73 qEREVPVVVDFTHPDCIYDNVRKAIAYGVRPVVGTTGLNNEQLQELAEFAEKASVGCLVIPNFSIGMVL 141 8889999************************************************************** PP TIGR00036 138 llkllekaakvledvDiEiiElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveeregltGerkk.. 204 l++++ +a++ ++v Ei+ElHH++K+DaPSGTA+k+a+++a+ + +++ v+e+e+++G+r++ lcl|FitnessBrowser__SynE:Synpcc7942_2136 142 LMQAAIQASRFYDHV--EILELHHDQKADAPSGTAIKTAQMLAELGK-TFNPPKVTEKETMPGARGAvg 207 *******99988888..***************************999.9****************7522 PP TIGR00036 205 .eeiGiaavRggdvvgehtvlFasdGerleitHkassRaafakGvvrairwledkeekvydledvl 269 e+i i++vR+++++++++v+F+ Ge l+++H++++R++++ Gv++a+r++ ++ ++y+l+ +l lcl|FitnessBrowser__SynE:Synpcc7942_2136 208 pENIRIHSVRLPGLIAHEEVIFGAPGEILTLRHDTMDRSCYMPGVLLAVRKVRQLTGLIYGLDRIL 273 26777*********************************************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (273 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.26 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory