Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate Synpcc7942_0191 Synpcc7942_0191 Serine--glyoxylate transaminase
Query= BRENDA::P74281 (384 letters) >FitnessBrowser__SynE:Synpcc7942_0191 Length = 382 Score = 514 bits (1324), Expect = e-150 Identities = 260/383 (67%), Positives = 308/383 (80%), Gaps = 1/383 (0%) Query: 1 MDNKQMLMIPGPTPVPEKVLLAMAKHPIGHRSGDFSKIIAELTANLKWLHQTENDVLMLT 60 M++K MLMIPGPTPVPE+VLLAMAKHPIGHRS DFS+++A+ TA LKWLHQT +VL+L Sbjct: 1 MEDKLMLMIPGPTPVPEQVLLAMAKHPIGHRSADFSRLVADTTAGLKWLHQTTGNVLVLC 60 Query: 61 TSGTGAMEASIINFLSPGDRVLVGNNGKFGDRWVKVAKTFGLAVEEIKAEWGKALDPNDF 120 +SGTGAMEA IINFLS GDRVL NGKFG+RWVK+A+ FGL V+ ++A WGK LDP Sbjct: 61 SSGTGAMEAGIINFLSAGDRVLCCENGKFGERWVKLAQAFGLDVDLVQAPWGKPLDPEAI 120 Query: 121 KTLLEADSDKTIKALIITHSETSTGVLNDLAAINAAAKAHGGALMIVDAVTSLGATPVAI 180 + LEAD+DK IKA+I+THSETSTGV+NDL I+ +AHG AL IVDAVTSLGA V I Sbjct: 121 RAKLEADTDKQIKAVILTHSETSTGVINDLETISGYIRAHG-ALSIVDAVTSLGAANVPI 179 Query: 181 DDLGLDVVASGSQKGYMIPPGLGFVSVSAKAWQAYETATIPRFYLDLKKYKKSTDEDSSP 240 D GLDVVASGSQKGYMIPPGLGFV+VS +AW+AYETAT+P+FYLDL KY+K+ +DS+P Sbjct: 180 DAWGLDVVASGSQKGYMIPPGLGFVAVSDRAWKAYETATLPKFYLDLGKYRKAAQKDSNP 239 Query: 241 FTPPINLMYGLQASLQMMKAEGLDAIFTRHQRHTNATRGAMKALNLPLFAPDNAASNAIT 300 FTPP+NL Y L A+L++M+ EGL+ IF RH + T ATR A+KALNLPL+A D S AIT Sbjct: 240 FTPPVNLYYALDAALKIMQREGLENIFARHAKLTRATRAAIKALNLPLYAADEVGSPAIT 299 Query: 301 AVAPLGVEAEKIRSTMRKKFDIAMAGGQDHLKGKIFRIGHLGFVCDRDILSCIGALEATL 360 AVAP+ V AE IRS +K FDI +AGGQD LKGKIFRIGHLGFV RD+L+ I A+EA L Sbjct: 300 AVAPVEVAAEDIRSFTKKHFDILLAGGQDDLKGKIFRIGHLGFVSGRDVLTAIAAIEAAL 359 Query: 361 IELGYEGVTPGSGVAAAAGVLAK 383 LGY T G+GVAAAA LAK Sbjct: 360 TGLGYSNFTSGAGVAAAAAELAK 382 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 433 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 382 Length adjustment: 30 Effective length of query: 354 Effective length of database: 352 Effective search space: 124608 Effective search space used: 124608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory