Align phosphoserine aminotransferase monomer (EC 2.6.1.1; EC 2.6.1.52) (characterized)
to candidate Synpcc7942_0191 Synpcc7942_0191 Serine--glyoxylate transaminase
Query= metacyc::MONOMER-15919 (385 letters) >FitnessBrowser__SynE:Synpcc7942_0191 Length = 382 Score = 268 bits (686), Expect = 1e-76 Identities = 152/374 (40%), Positives = 219/374 (58%), Gaps = 5/374 (1%) Query: 7 KKLLMIPGPTMVPPEVLNAMALPVIGHRTKDYSNLLEDTIEKLKKVFITENDTFLITGSG 66 K +LMIPGPT VP +VL AMA IGHR+ D+S L+ DT LK + T + ++ SG Sbjct: 4 KLMLMIPGPTPVPEQVLLAMAKHPIGHRSADFSRLVADTTAGLKWLHQTTGNVLVLCSSG 63 Query: 67 TAAMDMAISNIIKRGDKVLNIVTGNFGERFANIVKAYKGEAIRLDVEWGDMAEPEAVKEI 126 T AM+ I N + GD+VL G FGER+ + +A+ + + WG +PEA++ Sbjct: 64 TGAMEAGIINFLSAGDRVLCCENGKFGERWVKLAQAFGLDVDLVQAPWGKPLDPEAIRAK 123 Query: 127 LDKYDD--IKAVTVVHNETSTGARNPIKEIGEVVKDYDALYIVDTVSSLGGDYVNVDKFH 184 L+ D IKAV + H+ETSTG N ++ I ++ + AL IVD V+SLG V +D + Sbjct: 124 LEADTDKQIKAVILTHSETSTGVINDLETISGYIRAHGALSIVDAVTSLGAANVPIDAWG 183 Query: 185 IDICVTGSQKCLAAPPGLAAITVSEKAWEVIKKNDDKVGFYLDLLAYKKYYEEKKQTPYT 244 +D+ +GSQK PPGL + VS++AW+ + FYLDL Y+K +K P+T Sbjct: 184 LDVVASGSQKGYMIPPGLGFVAVSDRAWKAY-ETATLPKFYLDLGKYRK-AAQKDSNPFT 241 Query: 245 PSVNLTYALNVALDLVLEEGIENRVKRHERLAKATRAGLEAMGIELFAKERARSVTVTSA 304 P VNL YAL+ AL ++ EG+EN RH +L +ATRA ++A+ + L+A + S +T A Sbjct: 242 PPVNLYYALDAALKIMQREGLENIFARHAKLTRATRAAIKALNLPLYAADEVGSPAIT-A 300 Query: 305 KYPEGIEDSKFRGILSNKYNIVVAGGQKHLAGKIFRIGHMGICGEKEVLATLACVELALK 364 P + R ++I++AGGQ L GKIFRIGH+G ++VL +A +E AL Sbjct: 301 VAPVEVAAEDIRSFTKKHFDILLAGGQDDLKGKIFRIGHLGFVSGRDVLTAIAAIEAALT 360 Query: 365 ELGFEVKESGVEVA 378 LG+ SG VA Sbjct: 361 GLGYSNFTSGAGVA 374 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 382 Length adjustment: 30 Effective length of query: 355 Effective length of database: 352 Effective search space: 124960 Effective search space used: 124960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory