Align Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase; EC 1.2.1.103; EC 1.2.1.106 (uncharacterized)
to candidate Synpcc7942_1433 Synpcc7942_1433 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:A0RWW0 (348 letters) >FitnessBrowser__SynE:Synpcc7942_1433 Length = 352 Score = 251 bits (640), Expect = 3e-71 Identities = 136/343 (39%), Positives = 206/343 (60%), Gaps = 7/343 (2%) Query: 1 MKVGVVGASGYVGGETLRLLVNHPDVEIAAVTSRQHVGEYLHRVQPSLRGFTDLTFSELD 60 + VG++GASGY G + +RLL +HP +E+A + + G+ + P L +LT +D Sbjct: 7 LPVGIIGASGYGGVQLVRLLQDHPQLEVAYLGGDRSAGKEFAELYPHLGPHLNLTIEAID 66 Query: 61 YDRLSDSCDLVFTAVPHGTATDIVRALYDRDIKVIDLSADYRLHDPADYTKWYGWEHPHP 120 DR+++ C VF ++P+G A D+ AL +R KV+DLSADYR HD Y WYG + Sbjct: 67 VDRIAERCAAVFLSLPNGLAYDLAPALLERGCKVLDLSADYRFHDLKTYALWYGGDRQDA 126 Query: 121 DYLSKSVFGIPELHREEIRSAKLVSCPGCMAVTSILALAPPVREGLVDTEHIVVDSKIGS 180 +++G+PEL+R I +A+L+ CPGC S+LALAP +++GL+D + IV+D+K G+ Sbjct: 127 AVAHTAIYGLPELYRNRIANAQLIGCPGCYPTASLLALAPALKQGLIDPDTIVIDAKSGT 186 Query: 181 SGAGAGAGT-AHAMRAG-VIRPYKPAKHRHTGEIEQELSGIAGKKIRVSMSPHAVDVVRG 238 SGAG A T A AG + Y A+HRHT EIEQ S ++G ++ + +PH + +VRG Sbjct: 187 SGAGRQAKTNALLAEAGNSVGAYGVARHRHTPEIEQICSDLSGHEVLLQFTPHLMPMVRG 246 Query: 239 ILCTNHVFL-TREASEKDLWKMYRQAYGEERFVRLIRDKKGLYKFPDPKFLVGSNFCDIG 297 I T + L + +D +Y+ Y V+++ G Y P K+ G+N C +G Sbjct: 247 IHATIYAKLRDPNLTTEDCLTVYQAFYRNAPMVKVL--THGTY--PQTKWAAGTNLCYLG 302 Query: 298 FDLDEDNNRLVAISASDNLMKGAAGSAIQNMNIMAGLDEMSGL 340 ++D R+V +SA DNL+KG AG AIQ +N+M G +E GL Sbjct: 303 LEVDARTGRIVLLSAIDNLIKGQAGQAIQCLNLMQGWEEGLGL 345 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 352 Length adjustment: 29 Effective length of query: 319 Effective length of database: 323 Effective search space: 103037 Effective search space used: 103037 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory