Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate Synpcc7942_1197 Synpcc7942_1197 indole-3-glycerol-phosphate synthase
Query= BRENDA::P00909 (453 letters) >FitnessBrowser__SynE:Synpcc7942_1197 Length = 295 Score = 169 bits (429), Expect = 8e-47 Identities = 113/259 (43%), Positives = 154/259 (59%), Gaps = 9/259 (3%) Query: 5 VLAKIVADKAIWVEARKQQQPLASFQNEVQPST---RHFYDALQGA--RTAFILECKKAS 59 +L +IV K V A ++Q PL QN+V+ T R F AL+ A R A I E KKAS Sbjct: 31 ILEEIVWYKEREVNAWREQLPLQQLQNQVRGLTQTPRDFLAALRQAPTRPAVIAEVKKAS 90 Query: 60 PSKGVIRDDFDPARIAAIYK-HYASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCKDFI 118 PSKGV+R+DFDP IA Y + A+ ISVLTDEK+FQG F L V P+LCKDF+ Sbjct: 91 PSKGVLREDFDPVAIAQAYAANGAACISVLTDEKFFQGGFENLQRVRAAVDVPLLCKDFV 150 Query: 119 IDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIAL- 177 I PYQIY AR ADA LL+ ++L D R +AHSL + L EV + E ER +AL Sbjct: 151 IYPYQIYKARLLGADAVLLIAAILSDADLRYFLKIAHSLGLNALVEVHSLPELERVLALD 210 Query: 178 GAKVVGINNRDLRDLSIDLNRTRELAPKL-GHNVTVISESGINTYAQVRELSHF-ANGFL 235 ++VGINNR+L+ DL T LA + ++ ++SESG+ T A + ++ A L Sbjct: 211 DLRLVGINNRNLKTFVTDLAVTEHLAAQCRDRDLLLVSESGLFTGADLDRVTQAGAQAVL 270 Query: 236 IGSALMAHDDLHAAVRRVL 254 IG +L+ D A+++++ Sbjct: 271 IGESLVKQPDPGLALQQLV 289 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 295 Length adjustment: 30 Effective length of query: 423 Effective length of database: 265 Effective search space: 112095 Effective search space used: 112095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory