Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate Synpcc7942_1829 Synpcc7942_1829 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Query= BRENDA::P16250 (240 letters) >FitnessBrowser__SynE:Synpcc7942_1829 Length = 256 Score = 185 bits (470), Expect = 7e-52 Identities = 108/238 (45%), Positives = 141/238 (59%), Gaps = 3/238 (1%) Query: 4 LELLPAVDVRDGQAVRLVHGESGTETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTG 61 ++++PA+D+ GQ VRL G+ YG P+ AL W +GA+ LHLVDLD A G+ Sbjct: 1 MDVIPAIDLLGGQCVRLFQGDYDQAEVYGKDPVGMALRWAEAGAQRLHLVDLDGAKEGSP 60 Query: 62 DNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEH 121 N IA +AQ + I V++ GG+RD DT+A L +G R LGT A+E P V + E Sbjct: 61 VNAEAIATIAQRLSIPVQVGGGLRDRDTVARLLDSGVERAILGTVAVERPALVEALAGEF 120 Query: 122 GDKIAVGLDVRGTTLRGRGWTRDGGDLYETL-DRLNKEGCARYVVTDIAKDGTLQGPNLE 180 +IAVG+D R + RGW D G L ++ G + TDI +DGTLQGPNLE Sbjct: 121 PGQIAVGIDARSGKVATRGWLEDSGLTAVALAQQMADLGACALICTDIGRDGTLQGPNLE 180 Query: 181 LLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEA 238 L+ + AA PV+ASGGV SL DL ++ L GV G IVGKALY A L+EAL A Sbjct: 181 ELRAIAAAVSIPVIASGGVGSLTDLLSLLPLEAQGVSGVIVGKALYTGAVDLQEALRA 238 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 256 Length adjustment: 24 Effective length of query: 216 Effective length of database: 232 Effective search space: 50112 Effective search space used: 50112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory