Align arogenate dehydrogenase (NADP+) (EC 1.3.1.78) (characterized)
to candidate Synpcc7942_0660 Synpcc7942_0660 arogenate dehydrogenase
Query= BRENDA::P73906 (279 letters) >FitnessBrowser__SynE:Synpcc7942_0660 Length = 323 Score = 273 bits (698), Expect = 4e-78 Identities = 143/278 (51%), Positives = 183/278 (65%) Query: 1 MKIGVVGLGLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLVDEAGQDLSLLQTAKI 60 M+IG+VGLGLIG SL D R RGH L+G SR+ +TCE+A+ R +VD A D ++L A++ Sbjct: 46 MRIGIVGLGLIGGSLGFDWRDRGHRLLGYSRRPATCERAIARGVVDHASPDPAVLTEAEV 105 Query: 61 IFLCTPIQLILPTLEKLIPHLSPTAIVTDVASVKTAIAEPASQLWSGFIGGHPMAGTAAQ 120 I L TP+ ++ T+ +L + P AIVTDV SVK I LW F+GGHPMAGTA Sbjct: 106 IVLATPLGVLETTVRELRDYWHPEAIVTDVGSVKQPIVAALDPLWPRFVGGHPMAGTAEN 165 Query: 121 GIDGAEENLFVNAPYVLTPTEYTDPEQLACLRSVLEPLGVKIYLCTPADHDQAVAWISHL 180 GI+ A LF N PYVLTPT+ TDP +A + + + LG + C PA HD+AVA ISHL Sbjct: 166 GIEAALRGLFQNRPYVLTPTDQTDPAAIAVVAQLAQELGSVVLHCDPASHDRAVATISHL 225 Query: 181 PVMVSAALIQACAGEKDGDILKLAQNLASSGFRDTSRVGGGNPELGTMMATYNQRALLKS 240 PV +SA+LIQ C E D + LA LASSGF DTSRVGGGNPELG MMA YNQ ALL+ Sbjct: 226 PVFISASLIQTCLQEPDPAVQTLAATLASSGFCDTSRVGGGNPELGVMMARYNQAALLEQ 285 Query: 241 LQDYRQHLDQLITLISNQQWPELHRLLQQTNGDRDKYV 278 + Y+ L++L T I+ P + +LQQ R +Y+ Sbjct: 286 IDRYQIQLERLKTAIAAADEPAIAAILQQNQEMRPRYL 323 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 323 Length adjustment: 27 Effective length of query: 252 Effective length of database: 296 Effective search space: 74592 Effective search space used: 74592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory