GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cmutase in Synechococcus elongatus PCC 7942

Align Chorismate mutase AroH; CM; EC 5.4.99.5 (characterized)
to candidate Synpcc7942_1915 Synpcc7942_1915 chorismate mutase

Query= SwissProt::P19080
         (127 letters)



>FitnessBrowser__SynE:Synpcc7942_1915
          Length = 130

 Score =  100 bits (250), Expect = 6e-27
 Identities = 49/122 (40%), Positives = 74/122 (60%)

Query: 3   IRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAV 62
           ++ IRGATTV  +T E + +   +LL+++   N   P+D+V +  S T DL A+FPA   
Sbjct: 5   VKAIRGATTVRENTAEAMREAVSELLDELERRNPLNPDDIVSLTFSVTRDLDAMFPAAVA 64

Query: 63  RELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKVVVLRPDLSLT 122
           R+ +GWQ VP+  +Q+M V G L++CIR+++       Q  I H YL    VLRPD  LT
Sbjct: 65  RQRAGWQNVPLLDVQQMYVEGSLERCIRLLLHFNCPEDQPPIEHPYLRGAQVLRPDWVLT 124

Query: 123 KN 124
           ++
Sbjct: 125 ES 126


Lambda     K      H
   0.318    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 66
Number of extensions: 6
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 127
Length of database: 130
Length adjustment: 14
Effective length of query: 113
Effective length of database: 116
Effective search space:    13108
Effective search space used:    13108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 41 (20.4 bits)

Align candidate Synpcc7942_1915 Synpcc7942_1915 (chorismate mutase)
to HMM TIGR01796 (aroH: chorismate mutase (EC 5.4.99.5))

Software error:

../bin/blast/fastacmd -i /tmp/list.5589.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.5589.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.