Align Cyclohexadienyl dehydrogenase and ADH prephenate dehydrogenase (characterized, see rationale)
to candidate Synpcc7942_0660 Synpcc7942_0660 arogenate dehydrogenase
Query= uniprot:Q92MG1 (307 letters) >FitnessBrowser__SynE:Synpcc7942_0660 Length = 323 Score = 144 bits (362), Expect = 4e-39 Identities = 90/285 (31%), Positives = 154/285 (54%), Gaps = 7/285 (2%) Query: 1 MAQQFQTIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSAA 60 +A+ I ++G+GLIG S+ D R++ ++ +R AT +RA G+ D + A Sbjct: 41 VARDVMRIGIVGLGLIGGSLGFDWRDR--GHRLLGYSRRPATCERAIARGVVDHASPDPA 98 Query: 61 EAVEGADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHFV 120 E A+++V++ P+G E+ + P AIVTDVGS K ++A + P P+ FV Sbjct: 99 VLTE-AEVIVLATPLGVLETTVRELRDYWHPEAIVTDVGSVKQPIVAALDPLWPR---FV 154 Query: 121 PGHPIAGTEHSGPDAGFAGLFRGRWCILTPPAGTDEEAVARLRLFWETLGSMVDEMDPKH 180 GHP+AGT +G +A GLF+ R +LTP TD A+A + + LGS+V DP Sbjct: 155 GGHPMAGTAENGIEAALRGLFQNRPYVLTPTDQTDPAAIAVVAQLAQELGSVVLHCDPAS 214 Query: 181 HDKVLAIVSHLPHIIAYNIVGTA-DDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDV 239 HD+ +A +SHLP I+ +++ T + + ++ ++SGF D +R+ +P + + Sbjct: 215 HDRAVATISHLPVFISASLIQTCLQEPDPAVQTLAATLASSGFCDTSRVGGGNPELGVMM 274 Query: 240 CLHNKDAILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIR 284 +N+ A+LE + R+ L L+ AI D + + + + +R Sbjct: 275 ARYNQAALLEQIDRYQIQLERLKTAIAAADEPAIAAILQQNQEMR 319 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 323 Length adjustment: 27 Effective length of query: 280 Effective length of database: 296 Effective search space: 82880 Effective search space used: 82880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory