Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate Synpcc7942_0853 Synpcc7942_0853 L,L-diaminopimelate aminotransferase
Query= BRENDA::Q8YTF2 (403 letters) >FitnessBrowser__SynE:Synpcc7942_0853 Length = 411 Score = 141 bits (355), Expect = 4e-38 Identities = 118/383 (30%), Positives = 170/383 (44%), Gaps = 36/383 (9%) Query: 37 LIDLGMGNPDGATPQPVVDAAIQALQDPKNH----GYPPFEGTASFRRAITNWYNRRYGV 92 +I LG+G+ P A IQA++D GY P +G A R I + G Sbjct: 36 IIRLGIGDVTEPLPVACRQAMIQAVEDMGQRENFKGYGPEQGYAWLREKIAAHDFQSRGC 95 Query: 93 VLDPDSEALPLLGSKEGLSHLAIAYVNPGDVVLVPSPAYPAHFRGPVIAG--------GT 144 +D SE GSK ++ + N + + V P YP + V+AG G Sbjct: 96 EVDA-SEIFISDGSKCDCGNILDIFGN-NNRIAVTDPVYPVYVDTNVMAGHTGDANDRGE 153 Query: 145 VHSLILKP---ENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAPREFFEEIVAFARK 201 L+ P EN++ + IP E K ++Y +P+NPTGA A RE+ + V +AR Sbjct: 154 YDGLVYLPISAENNFTAE---IPSE---KVDLIYLCFPNNPTGAVASREYLQAWVDYARA 207 Query: 202 YEILLVHDLCYAELAFDGYQPTSLLEIPGAKDIGVEFHTLSKTYNMAGWRVGFVV----- 256 +++ D Y D P S+ EIPGA+D +EF + SK G R F V Sbjct: 208 NGAIILFDAAYEAFITDPAIPHSIFEIPGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGL 267 Query: 257 ------GNRHVIQGLRTLKTNLDY-GIFAALQTAAETALQLP-DIYLHEVQQRYRTRRDF 308 G+ + GL + + + G+ +Q AE + E+ Y Sbjct: 268 KGKAADGSEVELWGLWNRRQSTKFNGVSYIVQRGAEAVYSAEGQAQIKELVAFYLENARI 327 Query: 309 LIQGLGELGWDVPKTKATMYLWVKCPVGMGSTDFALNLLQQTGVVVTPGNAFGVAGEGYV 368 + + L G DV Y+WVK P G+ S DF LLQ VV TPG+ FG AGEGY Sbjct: 328 IREELTAAGLDVHGGVNAPYVWVKTPAGLTSWDFFDKLLQVCNVVGTPGSGFGAAGEGYF 387 Query: 369 RISLIADCDRLGEALDRIKQAGI 391 RIS + + A+ RI+ AG+ Sbjct: 388 RISAFNSRENVVTAMQRIRSAGL 410 Lambda K H 0.321 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 411 Length adjustment: 31 Effective length of query: 372 Effective length of database: 380 Effective search space: 141360 Effective search space used: 141360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory