GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvE in Synechococcus elongatus PCC 7942

Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate Synpcc7942_1029 Synpcc7942_1029 branched-chain amino acid aminotransferase

Query= BRENDA::P54691
         (305 letters)



>FitnessBrowser__SynE:Synpcc7942_1029
          Length = 304

 Score =  457 bits (1177), Expect = e-133
 Identities = 219/303 (72%), Positives = 260/303 (85%)

Query: 1   MHKFLPIAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHG 60
           M+ FLP A+F  + VPF +A++S+ATHALHYGT AFGGLRGIPDPE+P  +LLFRLDRH 
Sbjct: 1   MNDFLPYAFFRGQLVPFPEAQLSIATHALHYGTGAFGGLRGIPDPENPDRVLLFRLDRHC 60

Query: 61  DRLSKSAKFLHYDISAEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDF 120
            RLS+SAKFLH+++SAE+I + I  FV+KNQP +SFYIRP VY+S LGIAPRLHN+EKDF
Sbjct: 61  QRLSQSAKFLHFELSAEEIFKAIEAFVQKNQPSQSFYIRPFVYTSDLGIAPRLHNIEKDF 120

Query: 121 LVYGLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180
            +YGL++GDYL+ +GVSCRISSWYRQEDRS PLRGKIS AYI S+LAKTEAV SGFDEAI
Sbjct: 121 FIYGLQLGDYLSPEGVSCRISSWYRQEDRSLPLRGKISGAYIASSLAKTEAVASGFDEAI 180

Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240
           LMNSQGKVCEATGMN+FMVRNG+++TPG +QDILEGITRDS++ +A DLGIP  QRPIDK
Sbjct: 181 LMNSQGKVCEATGMNLFMVRNGRLITPGYDQDILEGITRDSVIRVAQDLGIPVDQRPIDK 240

Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDRPITEKLRSVLTAVTENREPKYQDWVFK 300
           SEL IADEVFLSGTAAK+TPVK++EN+    DRPIT+++R  LT +TE R   YQDWVF 
Sbjct: 241 SELFIADEVFLSGTAAKVTPVKQVENYLTPCDRPITDQIRQQLTLITEGRLAAYQDWVFP 300

Query: 301 IPL 303
           I L
Sbjct: 301 IAL 303


Lambda     K      H
   0.320    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 353
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 305
Length of database: 304
Length adjustment: 27
Effective length of query: 278
Effective length of database: 277
Effective search space:    77006
Effective search space used:    77006
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate Synpcc7942_1029 Synpcc7942_1029 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

Software error:

../bin/blast/fastacmd -i /tmp/list.9347.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.9347.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.