GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asnB in Pseudomonas simiae WCS417

Align asparagine synthase (glutamine-hydrolysing) 1; EC 6.3.5.4 (characterized)
to candidate GFF2243 PS417_11435 asparagine synthase

Query= CharProtDB::CH_005185
         (632 letters)



>FitnessBrowser__WCS417:GFF2243
          Length = 634

 Score =  245 bits (626), Expect = 4e-69
 Identities = 179/581 (30%), Positives = 293/581 (50%), Gaps = 50/581 (8%)

Query: 1   MCGFVGVFNKHPLAQTADQEELIKQMNQMIVHRGPDSDGYFHDE--HVGFGFRRLSIIDV 58
           MCG++GVF K P A   +   +     + I HRGPDS   + D      FG+ RL ++ +
Sbjct: 1   MCGYIGVFAKQPRAFNPN---MFDAALRAIHHRGPDSSSQWFDPKGQAAFGYVRLGLVGL 57

Query: 59  ENGGQPLSYEDETYWIIFNGEIYNYIELREELEAKGYTFNTDSDTEVLLATYRHYKEEAA 118
            NG QP+  ++    ++ NGE Y+Y  +R ELE  G  F T SD+E+ +  YR +     
Sbjct: 58  GNGTQPIVADEGDLVMMVNGEFYDYQRIRTELEGYGCRFKTSSDSEIAMHLYRRHGVRGL 117

Query: 119 SKLRGMFAFLIWNKNDHVLYGARDPFGIKPLYYTTINDQVYFASERKSLMVAQNDIEIDK 178
            +LRG F  LI+++    L+  RD  G+KPLYYT      YFASE K+L+ A    + D 
Sbjct: 118 KQLRGEFTILIFDRLRKKLFAVRDRVGVKPLYYTEHEGAWYFASEIKALLAAGVPAQWDH 177

Query: 179 EALQQYMSFQFVPEPSTLDAHVKKVEPGSQFTIRPDGDITFKTYFKANFKPV----QTEE 234
           EA   Y +  F+    T+  +++ V+PG  + I  +  +  + Y+  +F       Q  E
Sbjct: 178 EA---YANRGFILRDRTVFNNIRSVKPGC-WIIADESGLQTEQYWDWDFPDAEATEQRSE 233

Query: 235 DKLVKEVRDAIYDSVNVHMRSDVPVGSFLSGGIDSSFIVSVAKEF-HPSLKTFSVGFE-Q 292
            ++++ +R+ I +SV + + +DVPVG  LSGG+DSS ++ +A E    SL+ F + FE +
Sbjct: 234 AEMIESLRNTIEESVRLRLHADVPVGVCLSGGLDSSAMLGIATELTGQSLQAFHLSFEGE 293

Query: 293 QGFSEVDVAKETA----AALGIENISKVISPEEYMNELPKIVWHFDDPLADPAAIPLYFV 348
           Q + E   A+  A    A L + +++     + + N L    WH + P A+  ++  Y +
Sbjct: 294 QAYDERQYAEVAARHNRAHLNVLSVNSSDMADNFENAL----WHAEMPFANAHSVAKYLL 349

Query: 349 AKEAKKH-VTVALSGEGADELFGGYNIYREPLSLKPFE-RIPSGLKKM--LLHVA--AVM 402
            K  +   +   L+GEGADE+FGGY  YR  + L   E + PS + ++   LH +    +
Sbjct: 350 CKYVQNQGMRAVLTGEGADEVFGGYPHYRRDMVLYNHENQDPSAIAELSRRLHASEDRYL 409

Query: 403 PEGMRG----KSLLERGCTPLQDR---YIGNAKIFEESVKKQLLKHYNPNLSYRDVTKTY 455
           P G       +  L  G + LQ +   +   A+++ +         ++   S+ D  + +
Sbjct: 410 PGGKNDVKWVQDELGHGVSWLQTQSALFGPLAQLYSDD--------FHERFSHTDAYREF 461

Query: 456 FTESS-----SYSDINKMQYVDIHTWMRGDILLK-ADKMTMANSLELRVPFLDKVVFDVA 509
           +   S      +  +N+  Y+   + +   +L    D+M MA SLE R P LD  V + A
Sbjct: 462 YDRLSPRALNGWEPVNRSLYMVAKSSLPNVVLTSLGDRMEMAGSLEGRPPLLDHQVIEAA 521

Query: 510 SKIPDELKTKNGTTKYLLRKAAEGIVPEHVLNRKKLGFPVP 550
            ++P  +K +  T KY LR+A    VP+ VL+RKK  F  P
Sbjct: 522 CRLPVNMKVRGATEKYALREAMRPYVPQAVLDRKKQYFRAP 562


Lambda     K      H
   0.319    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 887
Number of extensions: 43
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 632
Length of database: 634
Length adjustment: 38
Effective length of query: 594
Effective length of database: 596
Effective search space:   354024
Effective search space used:   354024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

Align candidate GFF2243 PS417_11435 (asparagine synthase)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.29534.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.29534.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.