Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate GFF4109 PS417_21050 serine acetyltransferase
Query= curated2:Q56002 (244 letters) >FitnessBrowser__WCS417:GFF4109 Length = 330 Score = 123 bits (309), Expect = 4e-33 Identities = 72/168 (42%), Positives = 102/168 (60%), Gaps = 10/168 (5%) Query: 3 KTLAADFRIIFERDPAARNGLEVLL-CYPGFQALVCHRVAHWLYQ---QRLPVIPRL--- 55 + +A D RDPA+R +++L Y F+A++ +R+AH ++ Q V R+ Sbjct: 43 QAVAEDLIAYAYRDPASRGRGDLILESYASFKAVLYYRLAHLVWHFPNQTNSVFSRIALK 102 Query: 56 LSHLSRLLTGVEIHPGARLGQGIFIDHGMGVVIGETAIVGDYCLIYQGVTLGGTG---KQ 112 LS+ ++L+G EIHP AR+G+ +DHG G VIGET +G+ C I GVTLG G Sbjct: 103 LSNQGKVLSGAEIHPAARIGRRFVLDHGYGTVIGETCEIGNDCYILCGVTLGARGIANNP 162 Query: 113 SGKRHPTLANNVVVGAGAKVLGNIQIGENVRIGAGSVVLRDVPSDCTV 160 GKRHP L NNV VG+GA+VLG + IG+NV I V+ +DVP+ V Sbjct: 163 DGKRHPRLGNNVEVGSGARVLGYVLIGDNVFISPSCVITQDVPAGTKV 210 Lambda K H 0.324 0.144 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 330 Length adjustment: 26 Effective length of query: 218 Effective length of database: 304 Effective search space: 66272 Effective search space used: 66272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory