GapMind for Amino acid biosynthesis

 

Alignments for a candidate for gatC in Pseudomonas simiae WCS417

Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate GFF836 PS417_04245 glutamyl-tRNA amidotransferase

Query= curated2:C1DQ38
         (95 letters)



>FitnessBrowser__WCS417:GFF836
          Length = 95

 Score =  149 bits (376), Expect = 7e-42
 Identities = 73/95 (76%), Positives = 87/95 (91%)

Query: 1  MALERSDVEKIAHLARLGLDDAEIPRTTQTLNDILGLIDRMQAVDTHGIEPLAHPLEATQ 60
          M LERSDVEKIAHLA LGL+DA++P+TT  LN ILGL+D+MQAV+T GIEPLAHPLEA+Q
Sbjct: 1  MTLERSDVEKIAHLASLGLNDADLPQTTAALNSILGLVDQMQAVNTDGIEPLAHPLEASQ 60

Query: 61 RLRPDEVTETDHRDAYQAIAPAVENGLYLVPKVIE 95
          RLR D VTE+++R+AYQ+IAPAVENGLYLVPKVI+
Sbjct: 61 RLRADVVTESNNREAYQSIAPAVENGLYLVPKVID 95


Lambda     K      H
   0.317    0.135    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 74
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 95
Length of database: 95
Length adjustment: 10
Effective length of query: 85
Effective length of database: 85
Effective search space:     7225
Effective search space used:     7225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.7 bits)
S2: 39 (19.6 bits)

Align candidate GFF836 PS417_04245 (glutamyl-tRNA amidotransferase)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))

Software error:

../bin/blast/fastacmd -i /tmp/list.17492.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.17492.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.