Align glutamine synthetase (EC 6.3.1.2) (characterized)
to candidate GFF5301 PS417_27140 gamma-glutamylputrescine synthetase
Query= BRENDA::P36205 (439 letters) >FitnessBrowser__WCS417:GFF5301 Length = 458 Score = 193 bits (491), Expect = 8e-54 Identities = 134/449 (29%), Positives = 219/449 (48%), Gaps = 32/449 (7%) Query: 11 EEENVRFIRLQFTDINGTLKNLEITPDVFLESWEDGIMF---------DGSSIEGF---V 58 + V ++ L D+NG ++ I + +E GI +GS++E + Sbjct: 19 DHPEVLYVDLLIADMNGVVRGKRIERTSLHKVYEKGINLPASLFALDINGSTVESTGLGL 78 Query: 59 RIEESDMYLKPVLDTFAVLPWTVDGAKSARVICDVYTPDGKPFEGDPRYRLRRMMEKAEQ 118 I ++D P+ DT PW +A+++ ++ +G+PF DPR LR+++ K + Sbjct: 79 DIGDADRICYPIPDTLCNEPW--QKRPTAQLLMTMHELEGEPFFADPREVLRQVVSKFDD 136 Query: 119 LGYTPYAGPEMEFFILPI-NEKGEPVPEFLDHGG-------YFDLLPLSKVEEIRRDIAI 170 LG T A E+EF+++ N G P P G + + L + + +DI Sbjct: 137 LGLTICAAFELEFYLIDQENVNGRPQPPRSPISGKRPHSTQVYLIDDLDEYVDCLQDILE 196 Query: 171 ALEKMGITVEATHHEVAPSQHEVDFRYDTF-LRTADNAQTVKLVIKTMAIFHGYHATFMP 229 ++ GI +A E AP+Q EV+ + ++ D A +K +IK +A H TFM Sbjct: 197 GAKEQGIPADAIVKESAPAQFEVNLHHVADPIKACDYAVLLKRLIKNIAYDHEMDTTFMA 256 Query: 230 KPFYGVNGSGMHVHMSLFRGDKNAFYDPDDPLGLSKELRYFVGGILKHAKALAAVTNPTI 289 KP+ G G+G+HVH+S+ D + +DP + LR+ +GG+L+ A A P + Sbjct: 257 KPYPGQAGNGLHVHISILDKDGKNIFASEDP-EQNAALRHAIGGVLETLPAQMAFLCPNV 315 Query: 290 NSYKRLVPGYEAPVYISWSVGNRSALIRIPKARGKATRLEYRSPDPSCNIYLAFAAILAA 349 NSY+R + P W + NR+ IR+P A R+E+R N YL A++LA Sbjct: 316 NSYRRFGAQFYVPNSPCWGLDNRTVAIRVPTGSSDAVRIEHRVAGADANPYLLMASVLAG 375 Query: 350 GLDGIINKIEPPAPVEENIYHMTSERREELNIESLPGSLKEAVEELKKDDVIIDALGEHI 409 G+ NKIEP APVE N Y E N +SLP +L++A+ EL +V+ + Sbjct: 376 VHHGLTNKIEPNAPVEGNSY--------EQNEQSLPNNLRDALRELDDSEVMAKYIDPKY 427 Query: 410 FEKFVEAAEKDWKEFSTYVTNWELQRYLY 438 + FV E + +EF +++ E YL+ Sbjct: 428 IDIFVACKESELEEFEHSISDLEYNWYLH 456 Lambda K H 0.320 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 490 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 458 Length adjustment: 33 Effective length of query: 406 Effective length of database: 425 Effective search space: 172550 Effective search space used: 172550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory