GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisF in Pseudomonas simiae WCS417

Align Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 (characterized)
to candidate GFF310 PS417_01580 imidazole glycerol phosphate synthase

Query= SwissProt::Q7SIB9
         (252 letters)



>FitnessBrowser__WCS417:GFF310
          Length = 256

 Score =  296 bits (757), Expect = 4e-85
 Identities = 153/256 (59%), Positives = 192/256 (75%), Gaps = 6/256 (2%)

Query: 1   MSLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEER 60
           M+LAKRI+PCLDV  GRVVKGV F N+RDAGDPVE AR YDE GADE+ FLDI+A+ + R
Sbjct: 1   MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGR 60

Query: 61  AILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADH 120
              L  V R+A +VFIPLTVGGGVR+++D R LL +GADKVS+N+AAV  PE + E A H
Sbjct: 61  DTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSINTAAVFNPEFVGEAAQH 120

Query: 121 FGAQAVVLAIDAR---WRGDFP--EVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMD 175
           FG+Q +V+AIDA+     G+ P  E+   GGR PTGL AVEWAVK   LGAGEILLTSMD
Sbjct: 121 FGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAVEWAVKMEGLGAGEILLTSMD 180

Query: 176 RDGTKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAG-AEAALAASVFHFGEIP 234
           +DG K G+DL +TR +++A+G+PVIASGG G ++H  +    G A A LAAS+FHFGE  
Sbjct: 181 QDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGVTEGHASAVLAASIFHFGEYT 240

Query: 235 IPKLKRYLAEKGVHVR 250
           +P+ K Y+A +G+ VR
Sbjct: 241 VPEAKAYMAARGIVVR 256


Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 244
Number of extensions: 14
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 252
Length of database: 256
Length adjustment: 24
Effective length of query: 228
Effective length of database: 232
Effective search space:    52896
Effective search space used:    52896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

Align candidate GFF310 PS417_01580 (imidazole glycerol phosphate synthase)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)

Software error:

../bin/blast/fastacmd -i /tmp/list.15525.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.15525.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.