Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate GFF4652 PS417_23805 acetolactate synthase 3 regulatory subunit
Query= BRENDA::P00894 (163 letters) >lcl|FitnessBrowser__WCS417:GFF4652 PS417_23805 acetolactate synthase 3 regulatory subunit Length = 163 Score = 210 bits (534), Expect = 1e-59 Identities = 102/162 (62%), Positives = 137/162 (84%), Gaps = 1/162 (0%) Query: 1 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60 MR I+S+LLENE GALSRV+GLFSQR YNIESLTVAPT+DPTLSR+T+ TVG ++V+EQI Sbjct: 1 MRHIISLLLENEPGALSRVVGLFSQRNYNIESLTVAPTEDPTLSRLTLTTVGHDEVIEQI 60 Query: 61 EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120 K L+KL++V+++ +L + AH+ERE+MLVK++A+G R E+KR T+I+RGQI+DV+ S+Y Sbjct: 61 TKNLNKLIEVVKLVDLSESAHIERELMLVKVKATGAQRAEIKRTTDIYRGQIVDVSASVY 120 Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIM 162 TVQL GTS KLD+F+ SI A I+E RSGV G++RGDK++ Sbjct: 121 TVQLTGTSDKLDSFIQSI-GTASILETVRSGVTGIARGDKVL 161 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 163 Length adjustment: 18 Effective length of query: 145 Effective length of database: 145 Effective search space: 21025 Effective search space used: 21025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate GFF4652 PS417_23805 (acetolactate synthase 3 regulatory subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00119.hmm # target sequence database: /tmp/gapView.9517.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00119 [M=158] Accession: TIGR00119 Description: acolac_sm: acetolactate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-67 210.2 2.3 9.1e-67 210.0 2.3 1.0 1 lcl|FitnessBrowser__WCS417:GFF4652 PS417_23805 acetolactate synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF4652 PS417_23805 acetolactate synthase 3 regulatory subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 210.0 2.3 9.1e-67 9.1e-67 1 158 [] 1 158 [. 1 158 [. 0.99 Alignments for each domain: == domain 1 score: 210.0 bits; conditional E-value: 9.1e-67 TIGR00119 1 kkhvlsvlvenepGvLsrvsGlfarrgfniesltvgeteekdlsrmtivvegddkvveqiekqleklvdvlkvld 75 ++h++s+l+enepG+Lsrv+Glf++r++niesltv+ te+++lsr+t+++ g+d+v+eqi+k l+kl++v+k +d lcl|FitnessBrowser__WCS417:GFF4652 1 MRHIISLLLENEPGALSRVVGLFSQRNYNIESLTVAPTEDPTLSRLTLTTVGHDEVIEQITKNLNKLIEVVKLVD 75 69************************************************************************* PP TIGR00119 76 lteseivkrelvlvkvsalgeerneikelteifrgrvvDvsedslivelsgkedkisaflkllkefgikevarsG 150 l+es++++rel+lvkv+a+g +r+eik++t+i+rg++vDvs + ++v+l+g++dk+++f++++ +i+e +rsG lcl|FitnessBrowser__WCS417:GFF4652 76 LSESAHIERELMLVKVKATGAQRAEIKRTTDIYRGQIVDVSASVYTVQLTGTSDKLDSFIQSIGTASILETVRSG 150 *************************************************************************** PP TIGR00119 151 lvalsrge 158 +++++rg+ lcl|FitnessBrowser__WCS417:GFF4652 151 VTGIARGD 158 ******85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (158 nodes) Target sequences: 1 (163 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 4.52 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory