Align 3-isopropylmalate dehydratase subunit LeuD (EC 4.2.1.33) (characterized)
to candidate GFF3633 PS417_18595 3-isopropylmalate dehydratase
Query= ecocyc::LEUD-MONOMER (201 letters) >FitnessBrowser__WCS417:GFF3633 Length = 214 Score = 256 bits (653), Expect = 3e-73 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 8/202 (3%) Query: 5 FIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLD------EKGQQP- 57 F +HTGLV PLD ANVDTD IIPKQFL+ + RTGFG +LF++WR+LD + ++P Sbjct: 4 FTQHTGLVAPLDRANVDTDQIIPKQFLKSIKRTGFGPNLFDEWRYLDVGYAYQDNSKRPL 63 Query: 58 NPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNN 117 N DFVLN +YQGAS+LLARENFGCGSSREHAPWAL +YGF+ +IAPS+ADIF+ NSF N Sbjct: 64 NKDFVLNAERYQGASVLLARENFGCGSSREHAPWALEEYGFRSIIAPSYADIFFNNSFKN 123 Query: 118 QLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEV-KAGEKTYRFTIDAFRRHCMMNGL 176 LLP+ L+D EVDELF V+A G VDL AQ V + K Y F +DAFR+HC++NGL Sbjct: 124 GLLPIILTDEEVDELFKQVEAEEGYQLTVDLAAQTVTRPDGKVYHFEVDAFRKHCLINGL 183 Query: 177 DSIGLTLQHDDAIAAYEAKQPA 198 D IGLTLQ DAIAA+EAK A Sbjct: 184 DDIGLTLQDGDAIAAFEAKHRA 205 Lambda K H 0.322 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 214 Length adjustment: 21 Effective length of query: 180 Effective length of database: 193 Effective search space: 34740 Effective search space used: 34740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate GFF3633 PS417_18595 (3-isopropylmalate dehydratase)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.14467.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-94 298.8 0.0 1e-93 298.5 0.0 1.1 1 lcl|FitnessBrowser__WCS417:GFF3633 PS417_18595 3-isopropylmalate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF3633 PS417_18595 3-isopropylmalate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 298.5 0.0 1e-93 1e-93 1 188 [] 1 196 [. 1 196 [. 0.94 Alignments for each domain: == domain 1 score: 298.5 bits; conditional E-value: 1e-93 TIGR00171 1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryld......ekGkep.npefvlnvpqyq 68 m+ f ++tGlv+pld+anvdtd+iipkqflk ikrtGfg +lf ewryld ++ k p n +fvln ++yq lcl|FitnessBrowser__WCS417:GFF3633 1 MRAFTQHTGLVAPLDRANVDTDQIIPKQFLKSIKRTGFGPNLFDEWRYLDvgyayqDNSKRPlNKDFVLNAERYQ 75 889*********************************************98333332234443589********** PP TIGR00171 69 gasillarenfGcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveellalvk.nkglkl 142 gas+llarenfGcGssrehapwal++yGf++iiaps+adif+nnsfkngllpi l++eev+el+++v+ ++g +l lcl|FitnessBrowser__WCS417:GFF3633 76 GASVLLARENFGCGSSREHAPWALEEYGFRSIIAPSYADIFFNNSFKNGLLPIILTDEEVDELFKQVEaEEGYQL 150 *******************************************************************9999**** PP TIGR00171 143 tvdleaqkvkdsegkvysfeidefrkhcllnGldeigltlqkedei 188 tvdl aq+v+ +gkvy+fe+d+frkhcl+nGld+igltlq d+i lcl|FitnessBrowser__WCS417:GFF3633 151 TVDLAAQTVTRPDGKVYHFEVDAFRKHCLINGLDDIGLTLQDGDAI 196 *****************************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (214 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.32 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory