Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate GFF1219 PS417_06195 succinyldiaminopimelate aminotransferase
Query= curated2:B1I544 (392 letters) >FitnessBrowser__WCS417:GFF1219 Length = 399 Score = 177 bits (450), Expect = 4e-49 Identities = 131/408 (32%), Positives = 202/408 (49%), Gaps = 42/408 (10%) Query: 9 IRNLPPYLFARIEQLIA------DKKAQGVDVISLGIGDPDVPTPDHIIEAAEKELKIPA 62 + L PY F ++ L+ DK+ I+L IG+P +P + EA L A Sbjct: 5 LNQLQPYPFEKLRALLGSVTPNPDKRP-----IALSIGEPKHKSPTFVAEALSNNLDQMA 59 Query: 63 NHQYPSSAGMPAYRRAVADWYARRFGVE---LDPQREVVSLIGSKEGIAHLPWCFVDPGD 119 YP++ G+PA R A+ W RRF V LDP R ++ + G++E + V+ GD Sbjct: 60 --VYPTTLGIPALREAIGAWCERRFNVPKGWLDPARNILPVNGTREALFAFTQTVVNRGD 117 Query: 120 VVLV--PDPGYPVYAGGTILAGGIPHPVPLTAGNGFLPDLAAIPAETARRAKVMFINYPN 177 LV P+P Y +Y G LAG PH +P NGF PD A+ + +R +++F+ P Sbjct: 118 DALVVSPNPFYQIYEGAAFLAGAKPHYLPCLDANGFNPDFEAVTPDIWKRCQILFLCSPG 177 Query: 178 NPTGAVASKEFFARVVDFAREYGILVCHDAAYSEIAFDGYRPPSFLEVAGAREVG----- 232 NPTGA+ + +++ A EY ++ D YSE+ FD PP L ++ E+G Sbjct: 178 NPTGALIPVDTLKKLIALADEYDFVIAADECYSELYFDEQSPPPGL-LSACVELGRQDFK 236 Query: 233 --IEFHSVSKTYNMTGWRAGWAAGNAGAVEALGRLKSNLDSGVFQVVQYAAIAALNGPQD 290 + FHS+SK N+ G R+G+ AG+A ++A ++ + Q A+IAA QD Sbjct: 237 RCVVFHSLSKRSNLPGLRSGFVAGDADILKAFLLYRTYHGCAMPVQTQLASIAAW---QD 293 Query: 291 GVQSLC--EMYRERRDLVVDTLNDLGWRLTRPRATFYIWAPVPAGHDASSFAEMVLEKAG 348 L ++YRE+ D V+ L + + P FY+W P G DA ++ +E+ Sbjct: 294 EAHVLANRDLYREKFDAVLAILKPV-LDVESPDGGFYLW-PNVNGDDAGFCRDLFVEE-H 350 Query: 349 VVITPGT-------GYGTYGEGYFRISLTLPTPRLVEAMERLRGCLGR 389 V + PG+ G+ G G R++L P VEA ER+R + R Sbjct: 351 VTVVPGSYLSREVDGFNP-GAGRVRLALVAPLAECVEAAERIRDFIQR 397 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 399 Length adjustment: 31 Effective length of query: 361 Effective length of database: 368 Effective search space: 132848 Effective search space used: 132848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory