Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate GFF4665 PS417_23870 aminotransferase
Query= SwissProt::Q2RK33 (390 letters) >FitnessBrowser__WCS417:GFF4665 Length = 390 Score = 148 bits (374), Expect = 2e-40 Identities = 118/387 (30%), Positives = 184/387 (47%), Gaps = 16/387 (4%) Query: 6 RIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPENHRYP 65 R R + P+ + + E + G D+I L IG+PD T +I A N + RY Sbjct: 8 RSRAIEPFHVMALLARANELQAAGHDVIHLEIGEPDFTTAEPIIKAGQAALANGKT-RYT 66 Query: 66 TSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINLVPDPG 125 + GL R+A++ +YQ+ YG+++DP R ++T GS + SL VDPG L+ DPG Sbjct: 67 AARGLPELREAISGFYQQRYGLNVDPARILITPGGSGALLLASSLL-VDPGKHWLLADPG 125 Query: 126 YPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGAVA--- 182 YP L G + +P+ + + + + + P NPTG + Sbjct: 126 YPCNRHFLRLVEGAAQLVPVGPEVRYQLTADLVAKHWNQDSVGALVASPANPTGTILTRD 185 Query: 183 DLKFFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPGAKEVGIEFNSVSKPYNM 242 +L ++ AR+ L+V D Y +TY G A S L+ V NS SK + M Sbjct: 186 ELAGLSAAIK-ARNGHLVV--DEIYHGLTY-GTDAASVLEVDDEAFV---LNSFSKYFGM 238 Query: 243 TGWRLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRV-YQERR 301 TGWRLGW + L ++ N+ A Q+A +A T + E RR + RR Sbjct: 239 TGWRLGWLVAPPAAVGELEKLAQNLYISAPSMAQHAALACFTPQTLSILEERRAEFGRRR 298 Query: 302 DIIVEGFNSLGWHLE-KPKATFYVWAPVPR-GYTSASFAEMVLEKAGVIITPGNGYGNYG 359 D ++ LG+ + +P+ FY++A + G + +F LE V TPG +G + Sbjct: 299 DFLLPALRELGFGIAVEPEGAFYLYADISAFGGDAFAFCRHFLETEHVAFTPGLDFGRFK 358 Query: 360 EG-YFRIALTISKERMQEAIERLRRVL 385 G + R A T + +R+QEA+ER+ R L Sbjct: 359 AGHHVRFAYTQNLDRLQEAVERIARGL 385 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 390 Length adjustment: 31 Effective length of query: 359 Effective length of database: 359 Effective search space: 128881 Effective search space used: 128881 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory