GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapA in Pseudomonas simiae WCS417

Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate GFF1410 PS417_07165 dihydrodipicolinate synthase

Query= BRENDA::Q9I4W3
         (292 letters)



>lcl|FitnessBrowser__WCS417:GFF1410 PS417_07165 dihydrodipicolinate
           synthase
          Length = 292

 Score =  472 bits (1215), Expect = e-138
 Identities = 239/291 (82%), Positives = 260/291 (89%)

Query: 1   MIAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVI 60
           MIAGSMVALVTP DAQG LDWDSL KLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVI
Sbjct: 1   MIAGSMVALVTPMDAQGHLDWDSLGKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVI 60

Query: 61  RRVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFR 120
             VV +V GRI VIAGTGANSTREA+ LT+ AK  GADACLLVTPYYNKPTQEG+YQHFR
Sbjct: 61  EFVVKRVAGRIAVIAGTGANSTREAIELTKNAKKAGADACLLVTPYYNKPTQEGLYQHFR 120

Query: 121 HIAEAVAIPQILYNVPGRTSCDMLPETVERLSKVPNIIGIKEATGDLQRAKEVIERVGKD 180
            IAEAV IPQILYNVPGRT+CDM   TV RLS VPNIIGIKEATGDLQRAK+++  V  D
Sbjct: 121 AIAEAVDIPQILYNVPGRTACDMQAATVIRLSTVPNIIGIKEATGDLQRAKDILAGVSSD 180

Query: 181 FLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMPLH 240
           FLVYSGDDATAVEL+LLGGKGNISVTANVAPRAMS++CAAA+ GDA  ARAI+++LMPL+
Sbjct: 181 FLVYSGDDATAVELILLGGKGNISVTANVAPRAMSEMCAAAIAGDAVTARAIHEKLMPLN 240

Query: 241 KALFIESNPIPVKWALHEMGLIPEGIRLPLTWLSPRCHEPLRQAMRQTGVL 291
           K LFIESNPIPVKWAL EMG++P+GIRLPLT LS  CHEPLRQA+RQ+GVL
Sbjct: 241 KTLFIESNPIPVKWALTEMGMMPDGIRLPLTRLSEACHEPLRQALRQSGVL 291


Lambda     K      H
   0.319    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 352
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 292
Length of database: 292
Length adjustment: 26
Effective length of query: 266
Effective length of database: 266
Effective search space:    70756
Effective search space used:    70756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate GFF1410 PS417_07165 (dihydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00674.hmm
# target sequence database:        /tmp/gapView.21369.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00674  [M=286]
Accession:   TIGR00674
Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   1.6e-119  384.0   0.1   1.8e-119  383.8   0.1    1.0  1  lcl|FitnessBrowser__WCS417:GFF1410  PS417_07165 dihydrodipicolinate 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF1410  PS417_07165 dihydrodipicolinate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  383.8   0.1  1.8e-119  1.8e-119       2     285 ..       5     287 ..       4     288 .. 0.99

  Alignments for each domain:
  == domain 1  score: 383.8 bits;  conditional E-value: 1.8e-119
                           TIGR00674   2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtgs 76 
                                         +++Al+TP++++g++d ++l kl+++++++g++aiv+vGtTGEsatL +eE+++vie++v+ v++r+ viaGtg+
  lcl|FitnessBrowser__WCS417:GFF1410   5 SMVALVTPMDAQGHLDWDSLGKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVIEFVVKRVAGRIAVIAGTGA 79 
                                         799************************************************************************ PP

                           TIGR00674  77 nateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLaee 151
                                         n+t+eaieltk a+k+g+d++l+vtPyYnkPtqeGly+hf aiae+v++P+ilYnvP+Rt+++++  tv+rL++ 
  lcl|FitnessBrowser__WCS417:GFF1410  80 NSTREAIELTKNAKKAGADACLLVTPYYNKPTQEGLYQHFRAIAEAVDIPQILYNVPGRTACDMQAATVIRLSTV 154
                                         *************************************************************************** PP

                           TIGR00674 152 veivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdteea 226
                                         ++i++iKea+gdl+r++ i a ++ df v+sGdDa++ e+++lG+kG iSV++nvap+ ++em++aa++gd   a
  lcl|FitnessBrowser__WCS417:GFF1410 155 PNIIGIKEATGDLQRAKDILAGVSSDFLVYSGDDATAVELILLGGKGNISVTANVAPRAMSEMCAAAIAGDAVTA 229
                                         *************************************************************************** PP

                           TIGR00674 227 reihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevlke 285
                                         r ih+kl++l k+lfie+NPipvK+al+ +g++    +RlPLt lse  +e l+++l++
  lcl|FitnessBrowser__WCS417:GFF1410 230 RAIHEKLMPLNKTLFIESNPIPVKWALTEMGMMPD-GIRLPLTRLSEACHEPLRQALRQ 287
                                         *********************************99.9*************999999876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (286 nodes)
Target sequences:                          1  (292 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 6.76
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory