GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapA in Pseudomonas simiae WCS417

Align 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 (characterized)
to candidate GFF2865 PS417_14640 dihydrodipicolinate synthase

Query= SwissProt::Q57695
         (289 letters)



>lcl|FitnessBrowser__WCS417:GFF2865 PS417_14640 dihydrodipicolinate
           synthase
          Length = 287

 Score =  153 bits (387), Expect = 4e-42
 Identities = 94/285 (32%), Positives = 146/285 (51%), Gaps = 8/285 (2%)

Query: 2   FKGVYPAIITPFKNKEVDFDGLEENINFLIENGVSGIVAVGTTGESPTLSHEEHKKVIEK 61
           F+G++  ++TPF +  +DF GL   ++ L+E  V+GI+   TTGE+  LS +E   V++ 
Sbjct: 4   FQGIWVPVVTPFHDGAIDFTGLHRLVSHLLEKHVAGIMVCTTTGEAAALSRQEQLAVLDA 63

Query: 62  VVDVVNGRVQVIAGAGSNCTEEAIELSVFAEDVGADAVLSI---TPYYNKPTQEGLRKHF 118
           V+  V     V+  AG N     IEL  F  ++    V  +    P Y +P+Q GL   F
Sbjct: 64  VLQWVPAHRVVMGLAGYN----QIELLQFQREILQRPVAGLLVPAPSYIRPSQAGLEAFF 119

Query: 119 GKVAESINLPIVLYNVPSRTAVNLEPKTVKLLAEEYSNISAVKEANPNLSQVSELIHDAK 178
             VA++ ++PI+LY++P RT    E  T+ L    +  I A+K+   NL     L+    
Sbjct: 120 RTVADASSVPIILYDIPYRTGATFEQATL-LNIVAHERIVAIKDCGGNLGNTLALLASGD 178

Query: 179 ITVLSGNDELTLPIIALGGKGVISVVANIVPKEFVEMVNYALEGDFEKAREIHYKLFPLM 238
           + VL G D      + LG  G I+  A++  ++FV +     +    +AR   ++L PL+
Sbjct: 179 VEVLCGEDVQIFNALCLGATGAIAASAHLQTEQFVALCQLVRDNQLAEARATFFELLPLI 238

Query: 239 KAMFIETNPIPVKTALNMMGRPAGELRLPLCEMSEEHKKILENVL 283
            AMF+E NP PVK AL + G    ELR P+   S      L+ VL
Sbjct: 239 NAMFMEPNPAPVKAALALQGLIGSELRAPMQAASTAVVARLQQVL 283


Lambda     K      H
   0.315    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 192
Number of extensions: 8
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 289
Length of database: 287
Length adjustment: 26
Effective length of query: 263
Effective length of database: 261
Effective search space:    68643
Effective search space used:    68643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 47 (22.7 bits)

Align candidate GFF2865 PS417_14640 (dihydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00674.hmm
# target sequence database:        /tmp/gapView.24672.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00674  [M=286]
Accession:   TIGR00674
Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
      8e-71  224.2   0.0      9e-71  224.0   0.0    1.0  1  lcl|FitnessBrowser__WCS417:GFF2865  PS417_14640 dihydrodipicolinate 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF2865  PS417_14640 dihydrodipicolinate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  224.0   0.0     9e-71     9e-71       4     284 ..       9     284 ..       6     286 .. 0.97

  Alignments for each domain:
  == domain 1  score: 224.0 bits;  conditional E-value: 9e-71
                           TIGR00674   4 tAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtgsna 78 
                                         + ++TPf++   +df+ l++l+++++ek+v +i+v+ tTGE+a+Ls +E+ +v+  +++ v    +v+ G ++ +
  lcl|FitnessBrowser__WCS417:GFF2865   9 VPVVTPFHDGA-IDFTGLHRLVSHLLEKHVAGIMVCTTTGEAAALSRQEQLAVLDAVLQWVPA-HRVVMGLAGYN 81 
                                         668****8877.*************************************************98.99********* PP

                           TIGR00674  79 teeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLaeeve 153
                                           e +++ +e+ + +v+g+lv +P+Y +P+q Gl ++f ++a+++++PiilY++P Rtg+ +e+ t+++++++++
  lcl|FitnessBrowser__WCS417:GFF2865  82 QIELLQFQREILQRPVAGLLVPAPSYIRPSQAGLEAFFRTVADASSVPIILYDIPYRTGATFEQATLLNIVAHER 156
                                         *************************************************************************** PP

                           TIGR00674 154 ivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdteeare 228
                                         ivaiK+++g+l +   + a  + d++vl+G+D+   + l+lGa+G i   +++ ++++  +++ + +++ +ear 
  lcl|FitnessBrowser__WCS417:GFF2865 157 IVAIKDCGGNLGNTLALLA--SGDVEVLCGEDVQIFNALCLGATGAIAASAHLQTEQFVALCQLVRDNQLAEARA 229
                                         ************9999988..569*************************************************** PP

                           TIGR00674 229 ihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevlk 284
                                            +ll+l++a+f+e+NP pvK+alal+gli + elR P+ ++s+    +l++vl+
  lcl|FitnessBrowser__WCS417:GFF2865 230 TFFELLPLINAMFMEPNPAPVKAALALQGLIGS-ELRAPMQAASTAVVARLQQVLN 284
                                         ********************************9.***********99999999985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (286 nodes)
Target sequences:                          1  (287 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.27
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory