Align phosphoserine aminotransferase; EC 2.6.1.52 (characterized)
to candidate GFF1596 PS417_08120 MFS transporter
Query= CharProtDB::CH_002572 (362 letters) >lcl|FitnessBrowser__WCS417:GFF1596 PS417_08120 MFS transporter Length = 361 Score = 405 bits (1042), Expect = e-118 Identities = 201/358 (56%), Positives = 253/358 (70%), Gaps = 2/358 (0%) Query: 5 FNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVP 64 +NF +GPA LP VL++AQ EL DW+G G SVME+SHR EF+ +A +AE+D RDLL++P Sbjct: 6 YNFCAGPAALPEAVLQRAQGELLDWHGKGLSVMEMSHRSDEFVSIATKAEQDLRDLLDIP 65 Query: 65 SNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVT 124 SNYKVLF GG QFA +PLN+L + TADY+D G W AI+EA +Y NV Sbjct: 66 SNYKVLFLQGGASQQFAQIPLNLLPEDGTADYIDTGIWGQKAIEEASRYGHVNVAGTAKP 125 Query: 125 VDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPI 184 D A+ EW+LS +AAY+HY NETI G+ D P+ G DV + D SS ILSRPI Sbjct: 126 YDYF-AIPGQNEWKLSKDAAYVHYVANETIGGLEFDWVPEVG-DVPLVCDMSSDILSRPI 183 Query: 185 DVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTF 244 DVS+YG+IYAGAQKNIGP+G+ + I+REDLLG+A CP++L+Y + DNGSM+NTPP F Sbjct: 184 DVSKYGMIYAGAQKNIGPSGILVNIIREDLLGRARSLCPTMLNYKVAADNGSMYNTPPAF 243 Query: 245 AWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNVPFQL 304 AWYLSGLVF+WLK GGVA M K+N++K +LY ID S Y N + +RS MNVPF+L Sbjct: 244 AWYLSGLVFEWLKEQGGVAAMGKLNEEKKRVLYDFIDASGLYSNPINLTDRSWMNVPFRL 303 Query: 305 ADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRHG 362 AD LDK FL + GL LKGHR VGGMRASIYNA+ + + AL ++M FE+ HG Sbjct: 304 ADDRLDKPFLVGAEERGLLNLKGHRSVGGMRASIYNAVDIHAINALVEYMAAFEKEHG 361 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 361 Length adjustment: 29 Effective length of query: 333 Effective length of database: 332 Effective search space: 110556 Effective search space used: 110556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF1596 PS417_08120 (MFS transporter)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.15574.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-163 530.0 0.0 1.5e-163 529.8 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF1596 PS417_08120 MFS transporter Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF1596 PS417_08120 MFS transporter # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 529.8 0.0 1.5e-163 1.5e-163 2 358 .] 6 360 .. 5 360 .. 0.99 Alignments for each domain: == domain 1 score: 529.8 bits; conditional E-value: 1.5e-163 TIGR01364 2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflqGGattq 76 +nF+aGPaalpe+vl++aq elld++g+glsvme+sHRs+ef +++++ae+dlr+Ll+ip+ny+vlflqGGa++q lcl|FitnessBrowser__WCS417:GFF1596 6 YNFCAGPAALPEAVLQRAQGELLDWHGKGLSVMEMSHRSDEFVSIATKAEQDLRDLLDIPSNYKVLFLQGGASQQ 80 8************************************************************************** PP TIGR01364 77 faavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelelkedaayvylcaneti 151 fa++plnll e+ +adyi tG w++ka++ea+++++ v+v+ +++ +y +ip ++e++l++daayv++ aneti lcl|FitnessBrowser__WCS417:GFF1596 81 FAQIPLNLLPEDGTADYIDTGIWGQKAIEEASRYGH-VNVAGTAKPYDYFAIPGQNEWKLSKDAAYVHYVANETI 154 **********************************99.************************************** PP TIGR01364 152 eGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivrkdllerakkelpsvldYki 226 G+ef+++pev ++plv+D+ssdilsr+idvskyg+iyaGaqKniGp+G+ v i+r+dll+ra++ +p++l+Yk+ lcl|FitnessBrowser__WCS417:GFF1596 155 GGLEFDWVPEVGDVPLVCDMSSDILSRPIDVSKYGMIYAGAQKNIGPSGILVNIIREDLLGRARSLCPTMLNYKV 229 *************************************************************************** PP TIGR01364 227 laendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYeaidesegfyknkvekkaRslmnvvFtl 301 +a+n s+yntpp fa+y++glv++wlke+GGv+++ k n+eK+++lY+ id+s g+y n+++ ++Rs+mnv+F+l lcl|FitnessBrowser__WCS417:GFF1596 230 AADNGSMYNTPPAFAWYLSGLVFEWLKEQGGVAAMGKLNEEKKRVLYDFIDAS-GLYSNPINLTDRSWMNVPFRL 303 ***************************************************99.6******************** PP TIGR01364 302 kkeelekeFlkeaeekglvslkGhrsvGGiRasiYnalpleevqaLvdfmkeFekkh 358 ++++l+k Fl aee+gl++lkGhrsvGG+RasiYna+ +++++aLv++m Fek+h lcl|FitnessBrowser__WCS417:GFF1596 304 ADDRLDKPFLVGAEERGLLNLKGHRSVGGMRASIYNAVDIHAINALVEYMAAFEKEH 360 ******************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory