Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase; EC 2.3.1.89 (characterized)
to candidate GFF4893 PS417_25075 hypothetical protein
Query= SwissProt::O34981 (236 letters) >FitnessBrowser__WCS417:GFF4893 Length = 188 Score = 73.6 bits (179), Expect = 3e-18 Identities = 48/154 (31%), Positives = 74/154 (48%), Gaps = 30/154 (19%) Query: 92 ARIEPGAIIRDQVEIGDNAVIMMGASINIGSVIGEGTMIDMNVVLGGRATVGKNCHIGAG 151 +R G +R +V + D+A + G ++ I G M R VG +C IG+ Sbjct: 39 SRFTAGVDLRIEV-LEDSACVTFGQNVKINDYCHIGAM--------SRVVVGDDCLIGSR 89 Query: 152 SVLA----GVIEPPS-----------------AKPVVIEDDVVIGANAVVLEGVTVGKGA 190 + GV PS KP++IE +V IG+ A+++ GVT+G+G+ Sbjct: 90 VTIVDHEHGVYRKPSDHPASLPWTPPDERLLQGKPIIIEKNVWIGSGAIIVGGVTIGEGS 149 Query: 191 VVAAGAIVVNDVEPYTVVAGTPAKKIKDIDEKTK 224 V+ A A+V D+ Y++ G PAK IK DE K Sbjct: 150 VIGANAVVTRDISRYSLAVGAPAKVIKTFDEGGK 183 Lambda K H 0.313 0.134 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 188 Length adjustment: 21 Effective length of query: 215 Effective length of database: 167 Effective search space: 35905 Effective search space used: 35905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory