Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate GFF3717 PS417_19025 aspartate aminotransferase
Query= SwissProt::P16524 (393 letters) >FitnessBrowser__WCS417:GFF3717 Length = 401 Score = 213 bits (542), Expect = 8e-60 Identities = 140/397 (35%), Positives = 209/397 (52%), Gaps = 24/397 (6%) Query: 1 MEHLLNPKAREI----EISGIRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDE 56 M+H L+ + I I+ + L AQ D+++ T+G+PDF TP H+ AAA +A+ Sbjct: 1 MKHFLSDRVLGIAPSPSIAANALVTELRAQGRDIVNFTVGEPDFDTPAHILAAASQAMHN 60 Query: 57 NVTSYTPNAGYLELRQAVQLYMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEV 116 T YT G L LRQA+ L +++ D Y + E++ G I A L+ GDEV Sbjct: 61 GDTHYTSTTGTLALRQAICLKLQQDNDLAYGLD-EVVAGCGGKHVIYHALAATLNRGDEV 119 Query: 117 IMPGPIYPGYEPIINLCGAKPVIVD-TTSHGFKLTARLIEDALTPNTKCVVLPYPSNPTG 175 I+ P + Y I L A PVI+ S GFKL+ +E A+T TK V+L P+NP+G Sbjct: 120 IVHTPYWVSYPDIARLNDATPVIIPGDESLGFKLSPDALEQAITARTKWVILNSPNNPSG 179 Query: 176 VTLSEEELKSIAALLKGR-NVFVLSDEIYSELTYDR----PHYSIATYLRDQTIVINGLS 230 +E EL ++A +L+ +V +++DEIY Y R P +A L+ +T+++NG S Sbjct: 180 AVYNETELLALAQVLRRHPHVLIMADEIYEHFIYGRARHVPLTRLAPDLKPRTLIVNGAS 239 Query: 231 KSHSMTGWRIGFLFAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQY 290 K ++MTGWR+GF P + I K+ +C SS+SQ AA+ A T MRE+Y Sbjct: 240 KGYAMTGWRLGFGAGPAWLIAAIAKLLSQTTTCPSSLSQAAAVAAFTGDQAPIAAMREEY 299 Query: 291 KKRLDYVYDRLVSM-GLDVVKPSGAFYIFPSIKSF--------GMTSFDFSMA--LLEDA 339 ++R + L + GL P GAFY+F ++ D + LL D Sbjct: 300 QQRRARMLALLADIPGLSCTPPDGAFYVFANVSGLMGKLTPQGDRLDSDTQLVDYLLRDY 359 Query: 340 GVALVPGSSFSTYGEGYVRLSFACSMDTLREGLDRLE 376 G+A V G+++ YVRLSFA S + + EG RL+ Sbjct: 360 GLATVSGAAYGM--SPYVRLSFASSSEVIEEGCRRLK 394 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 10 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 401 Length adjustment: 31 Effective length of query: 362 Effective length of database: 370 Effective search space: 133940 Effective search space used: 133940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory