Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate GFF1447 PS417_07360 ArtI protein
Query= BRENDA::Q01269 (268 letters) >FitnessBrowser__WCS417:GFF1447 Length = 257 Score = 246 bits (629), Expect = 3e-70 Identities = 127/250 (50%), Positives = 177/250 (70%), Gaps = 3/250 (1%) Query: 11 ALACLALLASASL-QAQESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQR 69 AL LA LA+++L S LD++L+ G L V TTGDYKP++ +G Y G D+ MA+ Sbjct: 6 ALCVLASLATSALADTTPSHLDQVLQRGTLTVCTTGDYKPYTSLRADGSYEGIDITMAES 65 Query: 70 LAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPIT 129 LA+SL AK+ VPT+W LM DF R DIA+ GIS++LERQ++A+FS DGK P+ Sbjct: 66 LAKSLNAKIQWVPTTWKTLMPDFLAQRCDIAVGGISVSLERQKKAFFSQSLGVDGKIPLV 125 Query: 130 LCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKA 189 C++ R+QT++QI+QP V I GGTNE FARA+L +A+I +H DNVTIF +++ GKA Sbjct: 126 RCADVQRYQTVDQINQPQVRVIEPAGGTNEVFARAHLGQAQIRLH-DNVTIFDELLAGKA 184 Query: 190 DLMMTDAIEARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDE-AFKRYVDQWLHIAEQSG 248 D+M+TDA EAR Q +L P LCAV+P++ ++EKA+LLPRD+ A+K YVDQWLH+++ +G Sbjct: 185 DVMITDASEARYQQKLKPGLCAVNPERQMQYSEKAFLLPRDDVAWKNYVDQWLHLSQATG 244 Query: 249 LLRQRMEHWL 258 + WL Sbjct: 245 AYDAIVSQWL 254 Lambda K H 0.322 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 257 Length adjustment: 25 Effective length of query: 243 Effective length of database: 232 Effective search space: 56376 Effective search space used: 56376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory