Align Acetylornithine deacetylase; AO; Acetylornithinase; N-acetylornithinase; NAO; EC 3.5.1.16 (characterized)
to candidate GFF5313 PS417_27200 acetylornithine deacetylase
Query= SwissProt::P23908 (383 letters) >FitnessBrowser__WCS417:GFF5313 Length = 382 Score = 363 bits (933), Expect = e-105 Identities = 191/379 (50%), Positives = 244/379 (64%), Gaps = 5/379 (1%) Query: 5 LPPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPV-PGTRNKFN 63 LP E + ALIA PS+S T+ +LDQ+N +I LLA W DLGF +++Q V PG KFN Sbjct: 3 LPSMKEQFAALIAAPSVSCTQASLDQTNRPVIDLLASWLGDLGFAIDIQQVSPG---KFN 59 Query: 64 MLASIGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDA 123 +LAS G G GGL+LAGH+DTVP+D W DP LTE DG+ GLG+ DMKGFFA ++A Sbjct: 60 LLASFGSGPGGLVLAGHSDTVPYDAALWKTDPLKLTEVDGRWVGLGSCDMKGFFALAIEA 119 Query: 124 LRDVDVTKLKKPLYILATADEETSMAGARYFAETTALRPDCAIIGEPTSLQPVRAHKGHI 183 + + K+PL ILAT DEE+SM+GAR AE A+IGEPT L+P+R HKG + Sbjct: 120 VLPLLDQTFKQPLLILATCDEESSMSGARALAEAGRPLGRAAVIGEPTGLKPIRLHKGVM 179 Query: 184 SNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLNLGH 243 I I GQSGHSSDP+ G +A+E MHDAIG + LR + Y F+VP PT+N G Sbjct: 180 MERIDILGQSGHSSDPSLGHSALEAMHDAIGELRGLRLGWQREYRNPQFSVPQPTMNFGC 239 Query: 244 IHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELHPPIP 303 IHGGD NRIC C L D+RPLPGM L + L P++ER ++ L P +P Sbjct: 240 IHGGDNPNRICGQCSLEFDLRPLPGMDPEVLRAAIRQKLEPLAERHQVKIDYAPLFPAVP 299 Query: 304 GYECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPDEYLE 362 +E P + +LV V E+L G + E V + TEAP++Q L C TLVLGPG I AHQP EYLE Sbjct: 300 PFEQPEDTELVRVAERLTGHRAEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLE 359 Query: 363 TRFIKPTRELITQVIHHFC 381 + PT L+ ++I H+C Sbjct: 360 MSRLTPTVRLLRELIEHYC 378 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 382 Length adjustment: 30 Effective length of query: 353 Effective length of database: 352 Effective search space: 124256 Effective search space used: 124256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate GFF5313 PS417_27200 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.4183.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-119 385.0 0.0 2e-119 384.8 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF5313 PS417_27200 acetylornithine deac Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF5313 PS417_27200 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 384.8 0.0 2e-119 2e-119 3 365 .] 10 374 .. 8 374 .. 0.98 Alignments for each domain: == domain 1 score: 384.8 bits; conditional E-value: 2e-119 TIGR01892 3 lakLvafdsvsar......snvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvv 71 +a+L+a +svs + +n ++i++++++l +lg+a++ ++v g k+nlla+ G +g gglvl+Gh+D+v lcl|FitnessBrowser__WCS417:GFF5313 10 FAALIAAPSVSCTqasldqTNRPVIDLLASWLGDLGFAIDIQQVSPG--KFNLLASFG--SGPGGLVLAGHSDTV 80 789********99999999***************************9..*********..999************ PP TIGR01892 72 PvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakklieala 146 P+d a W +Dp++Lte dgr g+G++DmkGF+al+++av l + k+Pl ++++ Dee ++ Ga+ l+ea+ lcl|FitnessBrowser__WCS417:GFF5313 81 PYDAALWKTDPLKLTEVDGRWVGLGSCDMKGFFALAIEAVLPLLDQTFKQPLLILATCDEESSMSGARALAEAGR 155 ****************************************99999****************************** PP TIGR01892 147 rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvaladklkredleeaFtp 221 + + a++GePt+l+++R hkG + ++ + G++ghss+p G sa e +++++++l +l+ +re+ + F + lcl|FitnessBrowser__WCS417:GFF5313 156 PLGRAAVIGEPTGLKPIRLHKGVMMERIDILGQSGHSSDPSLGHSALEAMHDAIGELRGLRLGWQREYRNPQFSV 230 *************************************************************************** PP TIGR01892 222 pyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaeevkekapgfevkveelsatpalelee 296 p +t+n G ++GG+ n+i+++C l+++lRp+pGmdpe l a +++ +e++ e++ + + +a p +e +e lcl|FitnessBrowser__WCS417:GFF5313 231 PQPTMNFGCIHGGDNPNRICGQCSLEFDLRPLPGMDPEVLRAAIRQKLEPLAERHQVKIDYAPLFPAVPPFEQPE 305 ***************************************************8888777777788899999***** PP TIGR01892 297 daelvalleklaGaaaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrallerlv 365 d+elv+++e+l+G++ae+v++gtea++lq+lG+e++vlGPGdi ahqp+eY+e++ l+++ ll++l+ lcl|FitnessBrowser__WCS417:GFF5313 306 DTELVRVAERLTGHRAEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLEMSRLTPTVRLLRELI 374 *************************************************************99999875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.07 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory