Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate GFF1577 PS417_08025 acetylornithine aminotransferase
Query= curated2:Q5JFW3 (362 letters) >FitnessBrowser__WCS417:GFF1577 Length = 389 Score = 244 bits (623), Expect = 3e-69 Identities = 146/375 (38%), Positives = 212/375 (56%), Gaps = 25/375 (6%) Query: 8 LRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFEHDE 67 L RG G +WD++GR YLD +AG+ V +GH+HP V +S Q ++ ++ D Sbjct: 15 LSFTRGLGTRLWDQQGREYLDAVAGVAVTNVGHSHPRLVAAISEQAGLLLHTSNLYSIDW 74 Query: 68 REEMLEELSHWVDYEYVYMGNSGTEAVEAAIKFARLATGRSEI-----VAMTNAFHGRTL 122 ++ + + L+ + + NSG EA E A+K ARL + I V M NAFHGRTL Sbjct: 75 QQRLAQRLTQLSGLDRAFFNNSGAEANETALKLARLHGWKKGIEAPLVVVMENAFHGRTL 134 Query: 123 GSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITK----ETAAVIFEPIQGEGGIV 178 G+L+A+ R GF L F + F ++ AA EAITK AV+ EPIQGE G++ Sbjct: 135 GTLAASDGPSVRLGFQQLPGDFLKVRFGDL-AALEAITKAFGPRITAVLLEPIQGESGVL 193 Query: 179 PADEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGKGIGNGFP 237 PA +++ LRD G L++ DE+Q+G+ RTG + A +H G+ PD++T+ KG+GNG P Sbjct: 194 PAPSGYLQALRDHCTRQGWLMMLDEIQTGIGRTGTWFAFQHEGIVPDVMTLAKGLGNGVP 253 Query: 238 VSLTLTDLEIPR----GKHGSTFGGNPLACRAVATTLRILRRDRLVEKA---GEKFME-- 288 + L + + G HGSTFGGNPLACR T L I+ L++ A GE+ + Sbjct: 254 IGACLARAAVAQLFTPGSHGSTFGGNPLACRVGCTVLDIIEEQGLLQNAAQQGERLLARL 313 Query: 289 ----FSGERVVKTRGRGLMIGIVLRRPAGNYV-KALQERGILVNTAGNRVIRLLPPLIIE 343 +VV RG+GLMIGI L P + +A QE G+L+N ++IRLLPPL ++ Sbjct: 314 RVELNEHAQVVAIRGQGLMIGIELASPCRDLAQRAAQEHGLLINVTRGKIIRLLPPLTLD 373 Query: 344 GDTLEEARKEIEGVL 358 +E + I +L Sbjct: 374 TQEVEMIVRAITRLL 388 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 19 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 389 Length adjustment: 30 Effective length of query: 332 Effective length of database: 359 Effective search space: 119188 Effective search space used: 119188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory