Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate Ac3H11_900 N-acetylglutamate synthase (EC 2.3.1.1)
Query= BRENDA::P22567 (432 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_900 Length = 448 Score = 389 bits (999), Expect = e-112 Identities = 201/448 (44%), Positives = 286/448 (63%), Gaps = 27/448 (6%) Query: 4 YVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQ 63 +V W R +PYI+ R++TFV+ L GE + NI DL L+ ++G ++VLVHG RPQ Sbjct: 9 FVPWFRSVAPYIHKFRNQTFVIGLTGEAIAAGKLHNIAQDLALIQAMGVKIVLVHGFRPQ 68 Query: 64 IEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRV 123 + +LAA+G A +Y +R+TD+ L+C +A G LR IEA S + +PM GA +RV Sbjct: 69 VNEQLAAKGHAAKYSHGIRITDSVALDCAQEAAGQLRYEIEAAFSQGLPNTPMAGATVRV 128 Query: 124 AGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLA 183 GN +TARP+G+V+GVD+ H+G VR++D GI + LD ++VLLSP G+SPTGE FNL+ Sbjct: 129 ISGNFLTARPVGIVDGVDFQHSGLVRKVDVAGIRQTLDMGALVLLSPFGFSPTGEAFNLS 188 Query: 184 CEDVAMRAAIDLEAEKLILYGAEQGL-------------------LDASGKLVRELRPQQ 224 E+VA AI+L A+KLI QG+ L A+ L+ +L P Q Sbjct: 189 MEEVATSVAIELRADKLIFLTEVQGIRMSPTEPESDDNPIDTELPLAAAQALLAQLPPAQ 248 Query: 225 VPAHLQRLGNSYQAELLDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQ 284 P L +AC+AGV+RSHI+ + DG+LL E++ G GT+V E+ Sbjct: 249 QPTD--------TGFYLQHCVKACKAGVERSHILPFAVDGSLLLEVYVHDGIGTMVIDEK 300 Query: 285 FEQLREAGIEDVGGLIELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYP 344 E+LREA I+DVGG+++LI P E+ G LV+R R +ER+I ++I+E +G+I CAALYP Sbjct: 301 LEELREATIDDVGGILQLIEPFEKDGTLVKRDRTEIERDIATYTIIEHDGVIFGCAALYP 360 Query: 345 IADSEAGELACLAVNPEYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQ 404 +++ E+A + V+P+ + G G++LL+RIE+RAR LGL ++FVLTTRT HWF +RGFQ Sbjct: 361 YPEAKTAEMAAVTVSPQSQGTGDGEKLLKRIEQRARLLGLDSIFVLTTRTMHWFIKRGFQ 420 Query: 405 PSSVERLPAARASLYNFQRNSQVFEKSL 432 P + LP AR YN+ R SQV K L Sbjct: 421 PVDPDWLPDARKRKYNWDRKSQVLVKKL 448 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 448 Length adjustment: 32 Effective length of query: 400 Effective length of database: 416 Effective search space: 166400 Effective search space used: 166400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate Ac3H11_900 (N-acetylglutamate synthase (EC 2.3.1.1))
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.25281.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-187 607.4 0.0 8.9e-187 607.2 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 N-acetylglutamate synthase (EC 2 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 N-acetylglutamate synthase (EC 2.3.1.1) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 607.2 0.0 8.9e-187 8.9e-187 1 429 [] 9 448 .] 9 448 .] 0.95 Alignments for each domain: == domain 1 score: 607.2 bits; conditional E-value: 8.9e-187 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqiee 63 fv w+r++aPyi+++r++t+v+gl ge++++++l ++++d+al++++Gv++vlvhG rpq++e lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 9 FVPWFRSVAPYIHKFRNQTFVIGLTGEAIAAGKLHNIAQDLALIQAMGVKIVLVHGFRPQVNE 71 899************************************************************ PP TIGR01890 64 rlakrgrtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfv 126 +la++g ++y +G+r+td +l++++eaaG+lr +iea++s+ l+ntpmag+ ++v+sGnf+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 72 QLAAKGHAAKYSHGIRITDSVALDCAQEAAGQLRYEIEAAFSQGLPNTPMAGATVRVISGNFL 134 *************************************************************** PP TIGR01890 127 tarPiGvveGvdyehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsva 189 tarP+G+v+Gvd++h+G vrk+d++gir++ld + +vllsP+gfs+tGe+fnl+me+vatsva lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 135 TARPVGIVDGVDFQHSGLVRKVDVAGIRQTLDMGALVLLSPFGFSPTGEAFNLSMEEVATSVA 197 *************************************************************** PP TIGR01890 190 iklkadklillteedGildadGk.......lvaelsaqeveslverleeet....tarllsaa 241 i+l+adkli+lte++Gi + + + +el +++l+ +l + t +l++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 198 IELRADKLIFLTEVQGIRMSPTEpesddnpIDTELPLAAAQALLAQLPPAQqptdTGFYLQHC 260 *****************76544400001114555655556666665544437778999***** PP TIGR01890 242 vkalrgGvarshlvsyaedGallqelftrdGiGtlvskealesireatiddvggilelirPle 304 vka+++Gv+rsh++++a dG+ll+e++++dGiGt+v e+le++reatiddvggil+li+P+e lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 261 VKACKAGVERSHILPFAVDGSLLLEVYVHDGIGTMVIDEKLEELREATIDDVGGILQLIEPFE 323 *************************************************************** PP TIGR01890 305 eqGilvrrsrellereieefsviekdGliigcaalypyaeeevgelaclavsPeardggrGer 367 ++G+lv+r+r +er+i+ +++ie+dG+i+gcaalypy+e++++e+a ++vsP+ +++g+Ge+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 324 KDGTLVKRDRTEIERDIATYTIIEHDGVIFGCAALYPYPEAKTAEMAAVTVSPQSQGTGDGEK 386 *************************************************************** PP TIGR01890 368 llkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPearrklynyqrrskilvkkl 429 llk+ie+rar +Gl +fvlttrt hWf +rGf++++ d lP ar++ yn++r+s++lvkkl lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_900 387 LLKRIEQRARLLGLDSIFVLTTRTMHWFIKRGFQPVDPDWLPDARKRKYNWDRKSQVLVKKL 448 ************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (448 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.92 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory