GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argA in Acidovorax sp. GW101-3H11

Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate Ac3H11_900 N-acetylglutamate synthase (EC 2.3.1.1)

Query= BRENDA::P22567
         (432 letters)



>FitnessBrowser__acidovorax_3H11:Ac3H11_900
          Length = 448

 Score =  389 bits (999), Expect = e-112
 Identities = 201/448 (44%), Positives = 286/448 (63%), Gaps = 27/448 (6%)

Query: 4   YVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQ 63
           +V W R  +PYI+  R++TFV+ L GE +      NI  DL L+ ++G ++VLVHG RPQ
Sbjct: 9   FVPWFRSVAPYIHKFRNQTFVIGLTGEAIAAGKLHNIAQDLALIQAMGVKIVLVHGFRPQ 68

Query: 64  IEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRV 123
           +  +LAA+G A +Y   +R+TD+  L+C  +A G LR  IEA  S  +  +PM GA +RV
Sbjct: 69  VNEQLAAKGHAAKYSHGIRITDSVALDCAQEAAGQLRYEIEAAFSQGLPNTPMAGATVRV 128

Query: 124 AGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLA 183
             GN +TARP+G+V+GVD+ H+G VR++D  GI + LD  ++VLLSP G+SPTGE FNL+
Sbjct: 129 ISGNFLTARPVGIVDGVDFQHSGLVRKVDVAGIRQTLDMGALVLLSPFGFSPTGEAFNLS 188

Query: 184 CEDVAMRAAIDLEAEKLILYGAEQGL-------------------LDASGKLVRELRPQQ 224
            E+VA   AI+L A+KLI     QG+                   L A+  L+ +L P Q
Sbjct: 189 MEEVATSVAIELRADKLIFLTEVQGIRMSPTEPESDDNPIDTELPLAAAQALLAQLPPAQ 248

Query: 225 VPAHLQRLGNSYQAELLDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQ 284
            P              L    +AC+AGV+RSHI+ +  DG+LL E++   G GT+V  E+
Sbjct: 249 QPTD--------TGFYLQHCVKACKAGVERSHILPFAVDGSLLLEVYVHDGIGTMVIDEK 300

Query: 285 FEQLREAGIEDVGGLIELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYP 344
            E+LREA I+DVGG+++LI P E+ G LV+R R  +ER+I  ++I+E +G+I  CAALYP
Sbjct: 301 LEELREATIDDVGGILQLIEPFEKDGTLVKRDRTEIERDIATYTIIEHDGVIFGCAALYP 360

Query: 345 IADSEAGELACLAVNPEYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQ 404
             +++  E+A + V+P+ +  G G++LL+RIE+RAR LGL ++FVLTTRT HWF +RGFQ
Sbjct: 361 YPEAKTAEMAAVTVSPQSQGTGDGEKLLKRIEQRARLLGLDSIFVLTTRTMHWFIKRGFQ 420

Query: 405 PSSVERLPAARASLYNFQRNSQVFEKSL 432
           P   + LP AR   YN+ R SQV  K L
Sbjct: 421 PVDPDWLPDARKRKYNWDRKSQVLVKKL 448


Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 529
Number of extensions: 20
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 448
Length adjustment: 32
Effective length of query: 400
Effective length of database: 416
Effective search space:   166400
Effective search space used:   166400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate Ac3H11_900 (N-acetylglutamate synthase (EC 2.3.1.1))
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.21641.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.21641.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.