Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate Ac3H11_2576 5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19) / Cytidylate kinase (EC 2.7.4.25)
Query= BRENDA::Q9KRB0 (426 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2576 Length = 676 Score = 436 bits (1120), Expect = e-126 Identities = 240/435 (55%), Positives = 309/435 (71%), Gaps = 22/435 (5%) Query: 4 LTLQPIELISGEVNLPGSKSVSNRALLLAALASGTTRLTNLLDSDDIRHMLNALTKLGVN 63 L L P++ +GEV+LPGSKS+SNR LLLAAL++GTT + +LL SDD R ML+AL ++G Sbjct: 7 LDLPPLQAAAGEVHLPGSKSISNRVLLLAALSNGTTTVHDLLASDDTRVMLDALRQIGCT 66 Query: 64 YRLSADKTTCEVEGLGQAFHTTQPLELFLGNAGTAMRPLAAALCLGQGDYVLTGEPRMKE 123 + +T + GLG + P +LFLGNAGTAMRPL AAL L G++ L+G PRM E Sbjct: 67 --VDEAGSTVRITGLGGRLPQS-PAKLFLGNAGTAMRPLTAALALLGGEFELSGVPRMHE 123 Query: 124 RPIGHLVDALRQAGAQIEYLEQENFPPLRI-QGTGLQ----AGTVTIDGSISSQFLTAFL 178 RPIG L+DALRQ G QI+YL E +PPL+I G G+ A + + G +SSQFLTA L Sbjct: 124 RPIGDLIDALRQLGCQIDYLGNEGYPPLKIAHGQGVPSLALAEPIRVRGDVSSQFLTALL 183 Query: 179 MSAPLAQGK--VTIKIVGELVSKPYIDITLHIMEQFGVQVINHDYQEFVIPAGQSYVSPG 236 M+ PLA G + I++VGEL+SKPYI ITL ++ +FG+ V + ++Q F IPAG Y SPG Sbjct: 184 MALPLAAGTQAIVIEVVGELISKPYIAITLQLLARFGIVVGHQNWQRFTIPAGSRYQSPG 243 Query: 237 QFLVEGDASSASYFLAAAAIK-GGE----VKVTGIGKNSIQGDIQFADALEKMGAQIEWG 291 VE DASSASYF+A AI GGE +K+ G+G +SIQGDI+F +A MGA + G Sbjct: 244 SIHVEADASSASYFIALGAIATGGEAQKSIKIQGVGLDSIQGDIRFVEAARAMGAVVTGG 303 Query: 292 DDYVIARRGE--LNAVDLDFNHIPDAAMTIATTALFAKGTTAIRNVYNWRVKETDRLAAM 349 +++ RG L A++LD NHIPDAAMT+A AL+A+GTT + N+ +WRVKETDR+AAM Sbjct: 304 PNWLQIERGAWPLKAIELDCNHIPDAAMTLAVMALYAEGTTTLTNIASWRVKETDRIAAM 363 Query: 350 ATELRKVGATVEEGEDFIVITPPTKLIH---AAIDTYDDHRMAMCFSLVALSDT--PVTI 404 ATELRK+GATVEEG D+I +TPPT+ A+I TYDDHR+AMCFSL A + PV I Sbjct: 364 ATELRKLGATVEEGADYIRVTPPTQAADWKAASIHTYDDHRVAMCFSLAAFNPARLPVRI 423 Query: 405 NDPKCTSKTFPDYFD 419 DPKC +KTFPDYF+ Sbjct: 424 EDPKCVAKTFPDYFE 438 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 692 Number of extensions: 26 Number of successful extensions: 12 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 676 Length adjustment: 35 Effective length of query: 391 Effective length of database: 641 Effective search space: 250631 Effective search space used: 250631 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate Ac3H11_2576 (5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19) / Cytidylate kinase (EC 2.7.4.25))
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.8491.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-136 439.8 0.0 5.9e-136 439.5 0.0 1.1 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 5-Enolpyruvylshikimate-3-phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19) / Cytidyla # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 439.5 0.0 5.9e-136 5.9e-136 1 412 [. 17 443 .. 17 446 .. 0.94 Alignments for each domain: == domain 1 score: 439.5 bits; conditional E-value: 5.9e-136 TIGR01356 1 geikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveeekeelvieg 62 ge+++pgsKSis+R+lllaaL++g+t+v++lL s+Dt+++l+alr++G +v e++ ++ i+g lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 17 GEVHLPGSKSISNRVLLLAALSNGTTTVHDLLASDDTRVMLDALRQIGCTVDEAGSTVRITG 78 799*************************************************99******** PP TIGR01356 63 vgglkepe..aeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgae 122 gg + p+ a+l lgn+Gt++R+lt++lal++ge++l+g +++++RPi++l++aLr+lg++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 79 LGG-RLPQspAKLFLGNAGTAMRPLTAALALLGGEFELSGVPRMHERPIGDLIDALRQLGCQ 139 **9.5555559*************************************************** PP TIGR01356 123 ieskeeegslPlaisgp.....lkg.givelsgsaSsQyksalllaap..lalqavtleivg 176 i++ +eg++Pl+i + l + + ++++g++SsQ+++all+a p +qa +e+vg lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 140 IDYLGNEGYPPLKIAHGqgvpsLALaEPIRVRGDVSSQFLTALLMALPlaAGTQAIVIEVVG 201 **************644476776667999*******************53345566667777 PP TIGR01356 177 eklisrpyieitLkllksfgveveeederkivvkggqkykqk.evevegDaSsAafflaaaa 237 +lis+pyi itL+ll++fg+ v +++ ++++++ g y+++ +++ve+DaSsA++f+a++a lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 202 -ELISKPYIAITLQLLARFGIVVGHQNWQRFTIPAGSRYQSPgSIHVEADASSASYFIALGA 262 .************************999********9988888******************* PP TIGR01356 238 itge.....evtvenlgenstqgdkaiiivLeemGadveveeqrdveveg.asklkgvkvdi 293 i+ + ++++++g +s qgd ++++ ++mGa v+ + ++++e+ a lk+++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 263 IATGgeaqkSIKIQGVGLDSIQGDIRFVEAARAMGAVVTGGPN-WLQIERgAWPLKAIE--L 321 *876566678*********************************.9***98677888888..* PP TIGR01356 294 dvdsliDelptlavlaafAegetriknieelRvkEsdRiaaiaeeLeklGveveeledglli 355 d+++++D+++tlav+a++Aeg+t+++ni+++RvkE+dRiaa+a+eL+klG++vee++d++ + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 322 DCNHIPDAAMTLAVMALYAEGTTTLTNIASWRVKETDRIAAMATELRKLGATVEEGADYIRV 383 ************************************************************** PP TIGR01356 356 eGkk..kelkgavvdtydDHRiamalavlglaae.geveiedaecvaksfPeFfevleql 412 ++ + + +k a+++tydDHR+am+++++++ + +v+ied++cvak+fP++fe+l ++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2576 384 TPPTqaADWKAASIHTYDDHRVAMCFSLAAFNPArLPVRIEDPKCVAKTFPDYFEALFSV 443 ***99999***********************98868*******************98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (676 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 10.96 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory