Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate Ac3H11_4705 3-dehydroquinate synthase (EC 4.2.3.4)
Query= BRENDA::P07639 (362 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4705 Length = 367 Score = 357 bits (915), Expect = e-103 Identities = 192/347 (55%), Positives = 235/347 (67%), Gaps = 3/347 (0%) Query: 2 ERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQAG 61 E + + L RSY I + G + +F L S ++V+N T+APLY +R ++ Sbjct: 6 ECVSIDLEGRSYNIVVGEGSLHAATTFEGLPSAHAALIVSNTTIAPLYAATLRSAIKSRF 65 Query: 62 VNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQRG 121 V V+LPDGE YK+ L +F ALL R T L ALGGGVVGD+TGFAAASY RG Sbjct: 66 PVVHEVLLPDGEAYKNWETLQLIFDALLSNACDRKTVLFALGGGVVGDMTGFAAASYMRG 125 Query: 122 VRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELASG 181 V F+QVPTTLL+QVDSSVGGKTA+NHP GKNMIGAFYQP VV DL L +LP REL++G Sbjct: 126 VPFVQVPTTLLAQVDSSVGGKTAINHPQGKNMIGAFYQPRLVVCDLATLDSLPLRELSAG 185 Query: 182 LAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLRA 241 LAEVIKYG I D F +WLE +++ L+ D A+A+ +RR CE+KA VV+ DE+ETGLRA Sbjct: 186 LAEVIKYGPIADVDFLDWLESSIEDLMARDRAALAHAVRRSCEIKAWVVSQDEKETGLRA 245 Query: 242 LLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRAG 301 +LN GHTFGHAIEA MGYG WLHGE VAAGMVMAA S RLG +A +R+ L+ RAG Sbjct: 246 ILNFGHTFGHAIEAGMGYGVWLHGEGVAAGMVMAAELSRRLGLVDAAFVERLTALIARAG 305 Query: 302 LPVNGP---REMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRS 345 LP GP +A YL M DKK GE+R +L GK+ VR+ Sbjct: 306 LPTKGPVLDAADNAGRYLELMRIDKKSEGGEIRFVLIDGPGKAVVRA 352 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 367 Length adjustment: 29 Effective length of query: 333 Effective length of database: 338 Effective search space: 112554 Effective search space used: 112554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Ac3H11_4705 (3-dehydroquinate synthase (EC 4.2.3.4))
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.1273.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-119 384.7 0.0 2.5e-119 384.5 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 3-dehydroquinate synthase (EC 4. Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 3-dehydroquinate synthase (EC 4.2.3.4) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 384.5 0.0 2.5e-119 2.5e-119 1 334 [. 17 353 .. 17 363 .. 0.94 Alignments for each domain: == domain 1 score: 384.5 bits; conditional E-value: 2.5e-119 TIGR01357 1 ykvkvgegllk..klveelaekasklvvitdeeveklvaekleealkslgvevlvlvvpdge 60 y+++vgeg l+ +++e l +a+ ++++++ +++ l+a++l++a ks+ v+++++pdge lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 17 YNIVVGEGSLHaaTTFEGLP-SAHAALIVSNTTIAPLYAATLRSAIKSRFPVVHEVLLPDGE 77 67899999887333344444.57899**********************9999********** PP TIGR01357 61 esKsletvaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamv 122 +K++et++ + d+ll++ ++rk+vl a+GGGvvgD++GF+Aa+y+RG+++vqvPTtlla+v lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 78 AYKNWETLQLIFDALLSNACDRKTVLFALGGGVVGDMTGFAAASYMRGVPFVQVPTTLLAQV 139 ************************************************************** PP TIGR01357 123 DssvGGKtginlplgkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelf 184 DssvGGKt+in+p+gkN+iGafyqP++V++dl++l +lp rel++G+aEviK+g iad +++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 140 DSSVGGKTAINHPQGKNMIGAFYQPRLVVCDLATLDSLPLRELSAGLAEVIKYGPIADVDFL 201 ************************************************************** PP TIGR01357 185 eelekneklllklaelealeelikrsievKaevVeeDekesglRalLNfGHtlgHaiEallk 246 ++le+ ++l + + +al+++++rs+e+Ka vV++Deke+glRa+LNfGHt+gHaiEa ++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 202 DWLESSIEDLMAR-DRAALAHAVRRSCEIKAWVVSQDEKETGLRAILNFGHTFGHAIEAGMG 262 *****99998875.559********************************************* PP TIGR01357 247 yk.lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkk...klsveellk 304 y+ + HGe Va Gmv++a+ls++lgl++a +erl+al+ ++glptk + ++ +l+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 263 YGvWLHGEGVAAGMVMAAELSRRLGLVDAAFVERLTALIARAGLPTKGPVldaADNAGRYLE 324 ***********************************************9987667788999** PP TIGR01357 305 allkDKKnegskiklvlleeiGkaalasev 334 + DKK+eg++i++vl++ Gka+++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4705 325 LMRIDKKSEGGEIRFVLIDGPGKAVVR-AA 353 ***********************9987.44 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.25 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory