Align Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 (characterized)
to candidate Ac3H11_644 Cysteine synthase B (EC 2.5.1.47)
Query= SwissProt::P16703 (303 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_644 Length = 300 Score = 379 bits (973), Expect = e-110 Identities = 190/294 (64%), Positives = 231/294 (78%), Gaps = 4/294 (1%) Query: 3 TLEQTIGNTPLVKLQRMGPDN----GSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEI 58 T+E +GNTPLV LQR+G + G+ V KLEGNNPAGSVKDR ALSMI AE+RG+I Sbjct: 5 TIEDAVGNTPLVALQRIGAQDNAARGNVVLGKLEGNNPAGSVKDRPALSMIRRAEERGDI 64 Query: 59 KPGDVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQG 118 +PGD LIEATSGNTGIALAM AA+KGYRM L+MP+++S ER M+A+GAEL+L K G Sbjct: 65 RPGDTLIEATSGNTGIALAMAAAIKGYRMVLVMPEDLSIERAQTMKAFGAELVLTPKSGG 124 Query: 119 MEGARDLALEMANRGEGKLLDQFNNPDNPYAHYTTTGPEIWQQTGGRITHFVSSMGTTGT 178 ME ARDLA M RGEGK+LDQF NPDNP HY TTGPEIW+QTGGRITHFVS+MGTTGT Sbjct: 125 MEHARDLAEAMQKRGEGKVLDQFANPDNPRIHYETTGPEIWEQTGGRITHFVSAMGTTGT 184 Query: 179 ITGVSRFMREQSKPVTIVGLQPEEGSSIPGIRRWPTEYLPGIFNASLVDEVLDIHQRDAE 238 ITGVSRF++E++ + I+G QPEEGS IPGIR+WP EYLP I++AS VDE++ + Q +AE Sbjct: 185 ITGVSRFLKEKNPGIQIIGAQPEEGSRIPGIRKWPQEYLPKIYDASTVDELVYVGQDNAE 244 Query: 239 NTMRELAVREGIFCGVSSGGAVAGALRVAKANPDAVVVAIICDRGDRYLSTGVF 292 + R LA EGIF G+S+ GA A ++A +A +V ++CDRGDRYLSTGVF Sbjct: 245 DMCRRLAREEGIFAGISAAGACWVAQQIAARESNATIVFVVCDRGDRYLSTGVF 298 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 300 Length adjustment: 27 Effective length of query: 276 Effective length of database: 273 Effective search space: 75348 Effective search space used: 75348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_644 (Cysteine synthase B (EC 2.5.1.47))
to HMM TIGR01138 (cysM: cysteine synthase B (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01138.hmm # target sequence database: /tmp/gapView.32344.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01138 [M=290] Accession: TIGR01138 Description: cysM: cysteine synthase B Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-143 462.2 0.1 4.5e-143 462.0 0.1 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_644 Cysteine synthase B (EC 2.5.1.47 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_644 Cysteine synthase B (EC 2.5.1.47) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 462.0 0.1 4.5e-143 4.5e-143 1 290 [] 5 298 .. 5 298 .. 0.99 Alignments for each domain: == domain 1 score: 462.0 bits; conditional E-value: 4.5e-143 TIGR01138 1 tilklvGntplvrlkrllpe....edsevlvklegnnpaGsvkdrpalsmiveaekrGeikeG 59 ti+++vGntplv l+r++++ ++ vl klegnnpaGsvkdrpalsmi +ae rG+i++G lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_644 5 TIEDAVGNTPLVALQRIGAQdnaaRGNVVLGKLEGNNPAGSVKDRPALSMIRRAEERGDIRPG 67 89***************998667678899********************************** PP TIGR01138 60 dvlieatsGntGialamvaalkGykvkllmpdnvseerkaalkayGaelilvdkeeGmeGard 122 d+lieatsGntGialam+aa+kGy++ l+mp++ s er + +ka+Gael+l+ k Gme ard lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_644 68 DTLIEATSGNTGIALAMAAAIKGYRMVLVMPEDLSIERAQTMKAFGAELVLTPKSGGMEHARD 130 *************************************************************** PP TIGR01138 123 larelvrkgeeklldqfnnpdnpkahytstGieiwqqtkGrithfvsslGttGtimGvsrflk 185 la+ ++++ge+k+ldqf+npdnp+ hy +tG+eiw+qt+Grithfvs++GttGti+Gvsrflk lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_644 131 LAEAMQKRGEGKVLDQFANPDNPRIHYETTGPEIWEQTGGRITHFVSAMGTTGTITGVSRFLK 193 *************************************************************** PP TIGR01138 186 eqnpavqivGlqpaegsaieGlrrieseylpgifdaslvdrvvdveqedaediarelakkegi 248 e+np +qi+G qp+egs i+G+r++++eylp+i+das vd+ v+v q++aed+ r+la++egi lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_644 194 EKNPGIQIIGAQPEEGSRIPGIRKWPQEYLPKIYDASTVDELVYVGQDNAEDMCRRLAREEGI 256 *************************************************************** PP TIGR01138 249 fvGvssGgavaaalrlarelekavvvaiicdrGdrylstgvf 290 f G+s+ ga + a ++a ++a +v ++cdrGdrylstgvf lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_644 257 FAGISAAGACWVAQQIAARESNATIVFVVCDRGDRYLSTGVF 298 *****************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (300 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.45 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory