Align Glutamine synthetase; GS; EC 6.3.1.2; Glutamate--ammonia ligase; Glutamine synthetase III; GSIII (uncharacterized)
to candidate Ac3H11_1551 Glutamine synthetase type I (EC 6.3.1.2)
Query= curated2:P31592 (435 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1551 Length = 435 Score = 293 bits (751), Expect = 5e-84 Identities = 174/414 (42%), Positives = 242/414 (58%), Gaps = 17/414 (4%) Query: 16 YFMISYTDLFGGQRAKLVPAEAIADMQKDGAGFAGFA-TWLDLTPAHPDLFAVPDASSVI 74 Y++ + D+ G +AKLVPA+ + GAGFAGFA + + P + AV D S+ Sbjct: 6 YYLAQFVDIHGRPKAKLVPAKHKDMIFGAGAGFAGFAIAGMGMGPNGREFMAVGDRDSIR 65 Query: 75 QLPWKKDVAWVAADCVMDDRPVEQAPRVVLKRLVAEAAKE-GLRVKTGVEPEFFLISADG 133 +PW A V + +D +P PRV+LK+ +A+ + GL TG+EPEFFL+ A Sbjct: 66 PVPWMGSTASVTCEGYVDGKPHALDPRVILKKALAKFRETTGLEFFTGLEPEFFLLKAGA 125 Query: 134 S----VISDQFDTAEKPCYDQQAVMRRYDVIAEICDYMLELGWKPYQNDHEDANGQFEMN 189 + V++ + ++ +KPCYD + + D + E+ + E G YQ DHEDANGQFEMN Sbjct: 126 AAGSWVVATESESLDKPCYDFRHLSSVSDFLMELRAALEEAGIDVYQIDHEDANGQFEMN 185 Query: 190 WEYDDVLKTADKHSFFKFMVKSVAEKHGLRATFMPKPFKGLTGNGCHAHISVWDVDGRVN 249 + Y D LKTAD ++FK +++A+KHG+ +FMPKPF +G+G H H+S + N Sbjct: 186 FTYADALKTADNLTYFKMAAQAIAKKHGMLCSFMPKPFAERSGSGLHMHMSAGG-EFCDN 244 Query: 250 AFADK--EMAFGLSAQGKTFLGGIMKHAPALAAITNPTVNSYKRINAPRTTSGATWSPNT 307 AF DK LS FLGG+M +A AL AI P VNSYKR+ + SGATW+P Sbjct: 245 AFEDKTDPREMDLSPMAYQFLGGLMANAAALTAIAAPCVNSYKRLVKSGSRSGATWAPIN 304 Query: 308 VTWTGNNRTHMVRVPGPGRFELRLPDGAVNPYLLQAIIIAAGLEGIRSQADPGQHYDIDM 367 + + NNRT +VRVPG GR ELRLPD A NPYLL A +I AGL+GI + +PGQ + ++ Sbjct: 305 IAYGNNNRTALVRVPG-GRLELRLPDAAANPYLLTAAVIYAGLDGIERELEPGQPVNDNL 363 Query: 368 YAEGHLVKDAPR-----LPLNLLDALRAFDADEGLKAAIGAEFSSAYLKLKHLE 416 Y V D LP +L DAL DA E ++ +G F + YL +K E Sbjct: 364 YVLS--VADLAALGIKCLPTSLPDALDELDASEVMRRGLGEAFIAEYLAVKRAE 415 Lambda K H 0.320 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 435 Length adjustment: 32 Effective length of query: 403 Effective length of database: 403 Effective search space: 162409 Effective search space used: 162409 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate Ac3H11_1551 (Glutamine synthetase type I (EC 6.3.1.2))
to HMM TIGR03105 (glnT: glutamine synthetase, type III (EC 6.3.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03105.hmm # target sequence database: /tmp/gapView.6241.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03105 [M=435] Accession: TIGR03105 Description: gln_synth_III: glutamine synthetase, type III Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-167 542.6 0.0 3.3e-167 542.3 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 Glutamine synthetase type I (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 Glutamine synthetase type I (EC 6.3.1.2) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 542.3 0.0 3.3e-167 3.3e-167 11 435 .] 5 433 .. 2 433 .. 0.98 Alignments for each domain: == domain 1 score: 542.3 bits; conditional E-value: 3.3e-167 TIGR03105 11 kyvlaafvdllGvakaklvPvealdalakegagfaGfavsglglePadadllavpdldsliq 72 y la+fvd++G +kaklvP+++ d++ gagfaGfa+ g+g+ P+ +++av+d ds+ + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 5 DYYLAQFVDIHGRPKAKLVPAKHKDMIFGAGAGFAGFAIAGMGMGPNGREFMAVGDRDSIRP 66 69************************************************************ PP TIGR03105 73 lPwkpevawvaadlvvegkpvelapRvvlkkllaeaae.kgftlktGveceffllrre.edg 132 +Pw a v+++++v+gkp++l+pRv+lkk la+ e +g+++ tG+e+effll++ + g lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 67 VPWMGSTASVTCEGYVDGKPHALDPRVILKKALAKFREtTGLEFFTGLEPEFFLLKAGaAAG 128 *********************************9986537***************9862579 PP TIGR03105 133 klsvaDkaDklakpcYDqralmrrydvleeisealnelGwdlYqiDheDanGqfelnfeyaD 194 + +va ++++l+kpcYD r l+ d+l e+ +al+e G+d+YqiDheDanGqfe+nf+yaD lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 129 SWVVATESESLDKPCYDFRHLSSVSDFLMELRAALEEAGIDVYQIDHEDANGQFEMNFTYAD 190 99************************************************************ PP TIGR03105 195 alttaDrvaffkylvkeiaeeegllatfmPkPfadrtGnGlhlhlslldedgknlfaddade 256 al+taD++++fk++++ ia+++g+l++fmPkPfa+r+G+Glh+h+s e + n+f+d++d+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 191 ALKTADNLTYFKMAAQAIAKKHGMLCSFMPKPFAERSGSGLHMHMSAGGEFCDNAFEDKTDP 252 ************************************************************** PP TIGR03105 257 eglglsklayhfiaGilkhakaLaallaPtvnsYkRlvakrtlsgatWaPalisyggnnRth 318 +++ ls +ay+f++G++++a+aL+a++aP+vnsYkRlv++++ sgatWaP i+yg+nnRt+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 253 REMDLSPMAYQFLGGLMANAAALTAIAAPCVNSYKRLVKSGSRSGATWAPINIAYGNNNRTA 314 ************************************************************** PP TIGR03105 319 mvRiPdagRlelRlaDgaanpYlvsaavlaaGLdGierkldpgkrkdenlya...eelaekg 377 +vR+P +gRlelRl+D+aanpYl++aav+ aGLdGier+l+pg++ ++nly ++la+ g lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 315 LVRVP-GGRLELRLPDAAANPYLLTAAVIYAGLDGIERELEPGQPVNDNLYVlsvADLAALG 375 *****.9********************************************9999999**** PP TIGR03105 378 vetLPqtLlealraleadelleealGkelveeflklkreeweeyhrtvsdWeidryle 435 ++ LP++L +al++l+a+e++++ lG+++++e+l +kr e +e ++s+ e ry++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1551 376 IKCLPTSLPDALDELDASEVMRRGLGEAFIAEYLAVKRAECDELVLEISKAEFTRYVD 433 *****************************************************99975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (435 nodes) Target sequences: 1 (435 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.30 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory