Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate Ac3H11_4724 Histidinol dehydrogenase (EC 1.1.1.23)
Query= BRENDA::Q8G2R2 (430 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4724 Length = 460 Score = 392 bits (1006), Expect = e-113 Identities = 210/444 (47%), Positives = 284/444 (63%), Gaps = 20/444 (4%) Query: 5 LRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRIDLEK- 63 L D DFE+KF L + +++ V +I+ V++ GD+A+L+Y+ RFD + Sbjct: 10 LSTADADFEKKFQQCLHWSADTDAAIEQRVADILADVQKRGDAAVLEYTARFDGLSAPNM 69 Query: 64 TGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDR---YTDALGVELGSR 120 + +T+A+ AAFDA P + +AL+ A R+ +H Q Y D G LG + Sbjct: 70 AALELTQADFKAAFDAIPQAQRDALQAAAKRVRSYHEAQKKASGESWSYRDEDGTLLGQK 129 Query: 121 WTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAP---------------- 164 T ++ VG+YVPGG A+YPSS+LMNA+PA VAGV I+MVVP P Sbjct: 130 VTPLDRVGIYVPGGKAAYPSSLLMNAIPAHVAGVQEIIMVVPTPVRGSVATGGTGEGTST 189 Query: 165 DGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIV 224 G N LVL AA +AGV+ + +GGAQA+AALAYGT T+ V KI GPGNAYVA+AK+ V Sbjct: 190 KGERNELVLAAAYVAGVTRAFTIGGAQAVAALAYGTATVPKVDKITGPGNAYVASAKKRV 249 Query: 225 FGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEA 284 FGTVGIDMIAGPSE+L++AD PDW+A DL +QAEHD AQSIL+ D A+ AV+ Sbjct: 250 FGTVGIDMIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDAAYLDAVQRE 309 Query: 285 VERQLHTLARTETASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIR 344 ++R L T+ R E + S GA+IL KD E+A ++NRIA EHLE++ D + P +R Sbjct: 310 IDRLLPTMPRAEIIAKSLTGRGALILTKDMEEACAISNRIAPEHLEVSSTDPHRWEPLLR 369 Query: 345 NAGSIFIGGYTPEVIGDYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRAL 404 +AG+IF+G YT E +GDY G NHVLPT+ +ARFSS L V D+ KR+SL+++ + L Sbjct: 370 HAGAIFLGAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSEAGAQVL 429 Query: 405 GPAAIEIARAEGLDAHAQSVAIRL 428 G A E+A EGL AHAQ+ +RL Sbjct: 430 GKIAAELAYGEGLQAHAQAAEMRL 453 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 460 Length adjustment: 32 Effective length of query: 398 Effective length of database: 428 Effective search space: 170344 Effective search space used: 170344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate Ac3H11_4724 (Histidinol dehydrogenase (EC 1.1.1.23))
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.16093.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-158 511.4 0.3 6.7e-157 508.7 0.3 1.9 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 Histidinol dehydrogenase (EC 1.1 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 Histidinol dehydrogenase (EC 1.1.1.23) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 508.7 0.3 6.7e-157 6.7e-157 1 393 [] 39 452 .. 39 452 .. 0.95 Alignments for each domain: == domain 1 score: 508.7 bits; conditional E-value: 6.7e-157 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkv...kleslrvseeeleealeavdeelkealelaaen 59 v++i++dv+k+Gd+A+leyt +fd++ ++++l+++++++++a +a++++ ++al++aa++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 39 VADILADVQKRGDAAVLEYTARFDGLsapNMAALELTQADFKAAFDAIPQAQRDALQAAAKR 100 789**********************977788899**************************** PP TIGR00069 60 iekfhekqlpes...veveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAg 118 ++++he+q+++s +++++e+g+llgqkv+pl+rvg+YvPgGkaaypS++lm+a+pA+vAg lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 101 VRSYHEAQKKASgesWSYRDEDGTLLGQKVTPLDRVGIYVPGGKAAYPSSLLMNAIPAHVAG 162 ********9876677*********************************************** PP TIGR00069 119 vkeivvvtPpk...............kdgkvnpavlaaakllgvdevykvGGaqaiaalayG 165 v+ei++v P+ ++g+ n+ vlaaa ++gv++ +++GGaqa+aalayG lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 163 VQEIIMVVPTPvrgsvatggtgegtsTKGERNELVLAAAYVAGVTRAFTIGGAQAVAALAYG 224 *******996422333333333333246778999**************************** PP TIGR00069 166 tetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEvlviadesanpelvaaDllsqaE 227 t+tvpkvdki+GPGn+yV+ AKk vfg+vgidmiaGPsE+lv+ad s+ p++va+Dl+sqaE lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 225 TATVPKVDKITGPGNAYVASAKKRVFGTVGIDMIAGPSEILVLADGSTPPDWVAMDLFSQAE 286 ************************************************************** PP TIGR00069 228 Hdedaqailvttseelaekveeeveeqleelerkeiaekslekngaiilvddleealelsne 289 Hde aq+il++++++ +++v++e+++ l +++r+ei+ ksl+ +ga+il++d+eea+++sn+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 287 HDELAQSILLCPDAAYLDAVQREIDRLLPTMPRAEIIAKSLTGRGALILTKDMEEACAISNR 348 ************************************************************** PP TIGR00069 290 yApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtArfasglsve 351 +ApEHLe+ +dp+++ + +++aG++flG+yt+e+lgdy+aGpnhvLPTsgtArf+s+l+v+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 349 IAPEHLEVSSTDPHRWEPLLRHAGAIFLGAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVY 410 ************************************************************** PP TIGR00069 352 dFlkrisvqelskealeelaeaveklaeaEgLeaHaeavevR 393 dF+kr+s++e+s+++++ l++ +++la EgL+aHa+a+e+R lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4724 411 DFQKRSSLIEVSEAGAQVLGKIAAELAYGEGLQAHAQAAEMR 452 ***************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (460 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.05 # Mc/sec: 3.17 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory