Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate Ac3H11_4732 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)
Query= curated2:A6TKT6 (252 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4732 Length = 246 Score = 106 bits (264), Expect = 5e-28 Identities = 67/210 (31%), Positives = 110/210 (52%), Gaps = 11/210 (5%) Query: 6 IIPCLDVRKGRVVK---GVNFVDIKDAGDPVALARAYNDQGADEIVFLDITASHEERYIL 62 +IP +D++ G V+ G DP A+AR + D GA + +D+ + Sbjct: 3 LIPAIDLKDGHCVRLKQGDMDQSTTFGEDPAAMARKWVDAGARRLHLVDLNGAFAGVPKN 62 Query: 63 LDVVKKTSEEIF--IPLTVGGGIRTVEDMRQIIKSGADKVSINSSAVKNPSMITDCARQF 120 +K +E+ IP+ +GGGIR ++ + + I G V I ++AVKNP + D F Sbjct: 63 YGAIKSILKEVGSDIPVQLGGGIRDLDTIEKYIDGGLRYVIIGTAAVKNPGFLKDACSAF 122 Query: 121 GSQAVVIAMDVKRGADGRYEVYVRGGREKTGLEAVDWARRVAQLGAGEILLTSMDRDGTK 180 G +++ +D K G +V G + TG E VD A++ G I+ T + RDG Sbjct: 123 GGH-IIVGLDAKDG-----KVATDGWSKLTGHEVVDLAKKFEDWGVESIIYTDIGRDGML 176 Query: 181 SGYDLEITKRISQAVNIPVIASGGAGSVQD 210 SG +++ T +++QA++IPVIASGG ++ D Sbjct: 177 SGINIDATVKLAQALSIPVIASGGLSNMAD 206 Score = 37.7 bits (86), Expect = 2e-07 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 9/87 (10%) Query: 15 GRVVKGVNFVDIKDAGDP---------VALARAYNDQGADEIVFLDITASHEERYILLDV 65 G ++ G++ D K A D V LA+ + D G + I++ DI I +D Sbjct: 124 GHIIVGLDAKDGKVATDGWSKLTGHEVVDLAKKFEDWGVESIIYTDIGRDGMLSGINIDA 183 Query: 66 VKKTSEEIFIPLTVGGGIRTVEDMRQI 92 K ++ + IP+ GG+ + D+ Q+ Sbjct: 184 TVKLAQALSIPVIASGGLSNMADIEQL 210 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 252 Length of database: 246 Length adjustment: 24 Effective length of query: 228 Effective length of database: 222 Effective search space: 50616 Effective search space used: 50616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory