Align Histidinol-phosphatase (EC:3.1.3.15) (characterized)
to candidate Ac3H11_1314 Phosphoserine phosphatase (EC 3.1.3.3)
Query= reanno::BFirm:BPHYT_RS03625 (228 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1314 Length = 236 Score = 223 bits (567), Expect = 3e-63 Identities = 115/222 (51%), Positives = 147/222 (66%), Gaps = 4/222 (1%) Query: 4 LALFDLDHTLIPTDSDHEWGRFMVKHGMVDAENFARENDRFFADYKAGKLDIHAYLIAML 63 LALFDLDHTL+P DSD+EWG F ++ G D FAR ND F+A Y+AG L++H Y+ Sbjct: 10 LALFDLDHTLLPLDSDYEWGEFTIRIGWNDPVEFARRNDEFYAHYQAGTLNVHDYVRFAT 69 Query: 64 TPLSKYTRAQLADFHAQYMHEVIKPAIFPVALELVKQHRETGDLCCVVTATNEFITRPIA 123 + A H Q+M EVI PAI P AL+L++QH+ GD +VTATNEF+T PIA Sbjct: 70 EAVRLRGPEAAAAAHQQFMREVITPAIKPQALDLIRQHQAAGDEVLIVTATNEFVTGPIA 129 Query: 124 QAFGVDALIACEAETVDGEPHSPYTGRPTGTPSYKEGKIVRTEAWLASLGKTWSDFERSY 183 QA GV L+A + + + YTG G P+ +EGK+ R E WLA+ +W+D + S Sbjct: 130 QALGVPQLLAVQ---LVRDASGWYTGEIDGVPTMREGKVTRMEQWLAARQLSWADVD-ST 185 Query: 184 FYSDSHNDIPLLEKVTDPIATNPDDTLRAHAQAKGWRILELF 225 FYSDS ND+PLLEKV P+ATNPD LRA AQ +GWRIL+LF Sbjct: 186 FYSDSMNDVPLLEKVNRPVATNPDPRLRALAQQRGWRILDLF 227 Lambda K H 0.320 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 236 Length adjustment: 23 Effective length of query: 205 Effective length of database: 213 Effective search space: 43665 Effective search space used: 43665 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory