Align Ribose-phosphate pyrophosphokinase; RPPK; EC 2.7.6.1; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase (uncharacterized)
to candidate Ac3H11_2203 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)
Query= curated2:Q8TUT6 (291 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2203 Length = 303 Score = 142 bits (357), Expect = 1e-38 Identities = 96/284 (33%), Positives = 150/284 (52%), Gaps = 11/284 (3%) Query: 14 RRLAEELDAELAPVEEDRFPDGEQIVRVPPELDGTV----VVVHSMSPPQDENLVKAIIT 69 +RLA+ +E RFPDGE +R+P + G + V++ S+ P +E LV+ ++ Sbjct: 20 QRLAQAAGLTAQAIERHRFPDGELKLRLPVDASGRLPQRAVLLRSLHQP-NEKLVELLLA 78 Query: 70 LDAARENGAEEVIAIVPYMAYSRQDRRFEPGEPVSFRAVARAVSANADALITVD--LHEP 127 AR+ GA+ + + PY+AY RQD F PGE VS + V ++ DA+ITVD LH Sbjct: 79 ARTARQLGAQHLTLVAPYLAYMRQDIAFHPGEAVSQQVVGGFLAGLFDAVITVDPHLHRI 138 Query: 128 GTLKYFDVPAENV--SAAEELGKYLAERFEGEDLVVIGPDEGARELAREVASICGVEYDH 185 L+ + V S AE L +A+R G +++GPD + + + A+ ++ Sbjct: 139 ERLEQAMPVTQAVVLSGAEPLADLIAQRRPGA--LLVGPDGESAQWIAQAAARHSFDHAV 196 Query: 186 LEKKRLSGDEVEIHPKELDVEGRTVVLVDDMIDTGGTMVEAARALRDQGAGTLYAACTHA 245 K R V I L+ +GR VVL+DDM TG T+ A R L GA ++ A THA Sbjct: 197 CTKVRHGDRNVAIELPALNAQGRAVVLLDDMASTGRTLALATRLLLQAGAASVDVAVTHA 256 Query: 246 LLTRNAATRLLASGFEDIIATDTVPNPFEKVSVAPPVAEAVENL 289 L +A L +G ++ +TD +P+P V++A P+A A+ + Sbjct: 257 LFAGDALQVLTEAGVGEVWSTDCIPHPSNAVAMAGPLAAALHRV 300 Lambda K H 0.314 0.134 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 303 Length adjustment: 26 Effective length of query: 265 Effective length of database: 277 Effective search space: 73405 Effective search space used: 73405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_2203 (Ribose-phosphate pyrophosphokinase (EC 2.7.6.1))
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.9800.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-56 176.7 0.0 3.4e-56 176.4 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2203 Ribose-phosphate pyrophosphokina Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2203 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 176.4 0.0 3.4e-56 3.4e-56 12 283 .. 18 285 .. 9 302 .. 0.90 Alignments for each domain: == domain 1 score: 176.4 bits; conditional E-value: 3.4e-56 TIGR01251 12 laekvaknlglelgdvevkkFadgElyvri..eesvrgkdvfiivqstsapvndalmellll 71 a+++a+++gl +e ++F+dgEl+ r+ + s r +++++ s + + n++l+elll+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2203 18 PAQRLAQAAGLTAQAIERHRFPDGELKLRLpvDASGRLPQRAVLLRSLH-QPNEKLVELLLA 78 58999**********************9971155566669999988888.69********** PP TIGR01251 72 idalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiq 133 + ++++ +a+++t+v+Py++Y Rqd ++++e++s ++v+ +l+ + d v+tvd H + i+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2203 79 ARTARQLGAQHLTLVAPYLAYMRQDIAFHPGEAVSQQVVGGFLAGL-FDAVITVDPHLHRIE 139 **********************************************.*************99 PP TIGR01251 134 gfFd.vpven...lsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaiieKe 191 + +pv++ ls+++ l++ ++++ ++v PD ++++ ++a++ + a+ K+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2203 140 RLEQaMPVTQavvLSGAEPLADLIAQR-RPGALLVGPDGESAQWIAQAAARHSFDHAVCTKV 200 887766665433389999999999986.788899**************************** PP TIGR01251 192 RdskenevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgd 253 R+ + +v ++ ++ +g+ vv++DD+ sTg Tl+ a +lL ++GA +v va+th++f+gd lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2203 201 RH-GDRNVAIELPALNAQGRAVVLLDDMASTGRTLALATRLLLQAGAASVDVAVTHALFAGD 261 **.566******************************************************** PP TIGR01251 254 Alerlaeagveevivtntilveekklpkvs 283 Al+ l+eagv ev +t+ i++ + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2203 262 ALQVLTEAGVGEVWSTDCIPH------PSN 285 ********************9......333 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory