Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate Ac3H11_3452 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)
Query= BRENDA::P0A719 (315 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3452 Length = 324 Score = 409 bits (1050), Expect = e-119 Identities = 204/313 (65%), Positives = 256/313 (81%), Gaps = 2/313 (0%) Query: 2 PDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCA 61 PD +F GNA P +A IA L T+LG A VGRFSDGEV+V+I +NVR D+F++QSTCA Sbjct: 6 PDFMVFTGNANPGMAAEIAQHLGTTLGAADVGRFSDGEVTVEIKQNVRARDVFVVQSTCA 65 Query: 62 PTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVG 121 PTN+NLMEL++MVDAL+RASA RI+AVIPYFGYARQDRR RS RVPITAKVVA+ L +VG Sbjct: 66 PTNENLMELLIMVDALKRASAERISAVIPYFGYARQDRRPRSTRVPITAKVVANMLQAVG 125 Query: 122 VDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIA 181 V RVLT+DLHA+QIQGFFD+PVDN++ SP+LL D+ Q N ++ IVVSPD+GGVVRARA+A Sbjct: 126 VARVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLRQKNYEDLIVVSPDVGGVVRARALA 185 Query: 182 KLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGA 241 K L D+AIIDKRRP+ANVS+VMH+IG++ GR+CV++DDMIDT GTL KAAE LKERGA Sbjct: 186 KQLG-CDLAIIDKRRPKANVSEVMHVIGEIEGRNCVIMDDMIDTAGTLVKAAEVLKERGA 244 Query: 242 KRVFAYATHPIFSGNAANNL-RNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAI 300 K V+AY THPIFSG A + + S +DEVVV +TIPLSD K +R L+++ ++AE I Sbjct: 245 KSVYAYCTHPIFSGPAIERIAKGSALDEVVVTNTIPLSDNAKGCTKIRQLSVAPLIAETI 304 Query: 301 RRISNEESISAMF 313 +RI+ ES+ ++F Sbjct: 305 QRIAKGESVMSLF 317 Lambda K H 0.321 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 324 Length adjustment: 28 Effective length of query: 287 Effective length of database: 296 Effective search space: 84952 Effective search space used: 84952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_3452 (Ribose-phosphate pyrophosphokinase (EC 2.7.6.1))
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.18326.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-129 416.7 0.7 2.6e-129 416.5 0.7 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 Ribose-phosphate pyrophosphokina Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 416.5 0.7 2.6e-129 2.6e-129 2 309 .] 9 318 .. 8 318 .. 0.98 Alignments for each domain: == domain 1 score: 416.5 bits; conditional E-value: 2.6e-129 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvnd 63 +++ g++++ +a+++a++lg+ lg ++v +F+dgE+ v+i+++vr +dvf++ qst+ap+n+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 9 MVFTGNANPGMAAEIAQHLGTTLGAADVGRFSDGEVTVEIKQNVRARDVFVV-QSTCAPTNE 69 799*************************************************.********* PP TIGR01251 64 almellllidalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvlt 124 +lmell+++dalkrasa++++aviPy+gYaRqd++ + r pi+ak+va++l+++G+ rvlt lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 70 NLMELLIMVDALKRASAERISAVIPYFGYARQDRRPRsTRVPITAKVVANMLQAVGVARVLT 131 **********************************98758*********************** PP TIGR01251 125 vdlHseqiqgfFdvpvenlsaspklieelkkkelknlvvvsPDkGaverakkvakklglela 186 +dlH++qiqgfFd+pv+n++asp+l+ +l++k+ ++l+vvsPD G+v ra+++ak+lg++la lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 132 MDLHADQIQGFFDIPVDNIYASPVLLGDLRQKNYEDLIVVSPDVGGVVRARALAKQLGCDLA 193 ************************************************************** PP TIGR01251 187 iieKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathg 248 ii+K+R+ k+n+ ev++++g++eg+++vi+DD+i+T+gTlvkaae+Lke+GAk+v++++th+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 194 IIDKRRP-KANVSEVMHVIGEIEGRNCVIMDDMIDTAGTLVKAAEVLKERGAKSVYAYCTHP 254 *******.899*************************************************** PP TIGR01251 249 vfsgdAlerlaeag.veevivtntilv.ee.kklpkvseisvapliaeaiarihenesvssl 307 +fsg+A+er+a+ ++ev+vtnti+ ++ k + k++++svapliae+i ri+++esv sl lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 255 IFSGPAIERIAKGSaLDEVVVTNTIPLsDNaKGCTKIRQLSVAPLIAETIQRIAKGESVMSL 316 ***********98779***********766899***************************** PP TIGR01251 308 fd 309 f+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_3452 317 FS 318 95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.86 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory