Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate Ac3H11_3895 Competence protein F homolog, phosphoribosyltransferase domain; protein YhgH required for utilization of DNA as sole source of carbon and energy
Query= BRENDA::A3MV85 (297 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3895 Length = 243 Score = 42.0 bits (97), Expect = 1e-08 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 7/106 (6%) Query: 145 RVAVRNVYPAEEFAERLKGVDAVVSPDFGSLHRAEAVARILGVPYTYFEKYRDRETGAIT 204 R+ R + A+ L G A D SL R A G+P ++ R+ + GA Sbjct: 138 RLRERGFNQSALLAQHLAGAKA----DVHSLLRLHATEAQSGLPRA--QRLRNLQ-GAFA 190 Query: 205 LMPRRDLELRGARVAIVDDILSTGGTLVDACKAARTLGASEVYAAV 250 + P R L+G RV ++DD+++TG T+ A A R G + V V Sbjct: 191 VEPARAAALQGQRVVLLDDVMTTGATVHAATLALREAGVAHVAVVV 236 Lambda K H 0.322 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 243 Length adjustment: 25 Effective length of query: 272 Effective length of database: 218 Effective search space: 59296 Effective search space used: 59296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory