Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate Ac3H11_1527 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)
Query= uniprot:Q845W4 (216 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1527 Length = 221 Score = 338 bits (867), Expect = 5e-98 Identities = 165/220 (75%), Positives = 182/220 (82%), Gaps = 5/220 (2%) Query: 1 MEKFTVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDEWRYLDHGEPGQDNSK 60 M+KFTVH G+VAP+DRENVDTDAIIPKQFLKSIK+TGFGPN FDEWRYLD GEPG S Sbjct: 1 MQKFTVHKGLVAPMDRENVDTDAIIPKQFLKSIKKTGFGPNLFDEWRYLDKGEPGIPESA 60 Query: 61 RPLNPDFVLNQPRYQGASILVTRKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFFNNC 120 R NPDFVLN PRY+GASIL+ RKNFGCGSSREHAPWAL Q+GFRA+IAPSFADIFFNNC Sbjct: 61 RKPNPDFVLNLPRYKGASILIARKNFGCGSSREHAPWALDQFGFRAVIAPSFADIFFNNC 120 Query: 121 FKNGLLPIVLTEQQVDHLINETVAFNGYQLTIDLEAQVVRTPD-----GRDYPFEITAFR 175 FKNGLLPIVL E V L +E AF GYQLTIDLE QVV + G + PF++ AFR Sbjct: 121 FKNGLLPIVLPEATVAQLFDEVAAFPGYQLTIDLERQVVVRQNRDEVVGEEIPFDVIAFR 180 Query: 176 KYCLLNGFDDIGLTLRHADKIRQFEAERLAKQPWLNNKLV 215 KYCLLNGFDDIGLTLR +DKIR FEAERLA +PWL + +V Sbjct: 181 KYCLLNGFDDIGLTLRKSDKIRAFEAERLATKPWLAHTMV 220 Lambda K H 0.322 0.141 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 221 Length adjustment: 22 Effective length of query: 194 Effective length of database: 199 Effective search space: 38606 Effective search space used: 38606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate Ac3H11_1527 (3-isopropylmalate dehydratase small subunit (EC 4.2.1.33))
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.21627.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-83 262.9 0.0 9.9e-83 262.6 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1527 3-isopropylmalate dehydratase sm Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1527 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 262.6 0.0 9.9e-83 9.9e-83 1 188 [] 1 201 [. 1 201 [. 0.92 Alignments for each domain: == domain 1 score: 262.6 bits; conditional E-value: 9.9e-83 TIGR00171 1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryld.......ekGke 55 m++f ++Glv+p+d+ nvdtdaiipkqflk ik+tGfg +lf ewryld e ++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1527 1 MQKFTVHKGLVAPMDRENVDTDAIIPKQFLKSIKKTGFGPNLFDEWRYLDkgepgipESARK 62 899**********************************************9333333335689 PP TIGR00171 56 pnpefvlnvpqyqgasillarenfGcGssrehapwalkdyGfkviiapsfadifynnsfkng 117 pnp+fvln p+y+gasil+ar+nfGcGssrehapwal+++Gf+ +iapsfadif+nn+fkng lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1527 63 PNPDFVLNLPRYKGASILIARKNFGCGSSREHAPWALDQFGFRAVIAPSFADIFFNNCFKNG 124 ************************************************************** PP TIGR00171 118 llpirlseeeveellalvk.nkglkltvdleaqkvkdseg.....kvysfeidefrkhclln 173 llpi l+e++v +l+ v+ +g +lt+dle q v + + + f++ +frk clln lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1527 125 LLPIVLPEATVAQLFDEVAaFPGYQLTIDLERQVVVRQNRdevvgEEIPFDVIAFRKYCLLN 186 ******************989************9976553223338899************* PP TIGR00171 174 Gldeigltlqkedei 188 G+d+igltl+k d+i lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1527 187 GFDDIGLTLRKSDKI 201 *************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (221 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.67 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory